Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate WP_037447201.1 N825_RS04005 amino acid ABC transporter permease
Query= reanno::pseudo1_N1B4:Pf1N1B4_3432 (229 letters) >NCBI__GCF_000576635.1:WP_037447201.1 Length = 224 Score = 121 bits (303), Expect = 1e-32 Identities = 79/218 (36%), Positives = 118/218 (54%), Gaps = 13/218 (5%) Query: 8 VILDGVWLTLQLALSSMVLAIVLGLIGVALRLSPIRWLAWLGDLYSTVIRGIPDLVLILL 67 ++L G+ TL L ++S+V+ +V GL LRL + LA L Y + R IP LVL++L Sbjct: 19 LLLLGLGTTLSLGVTSIVIGLVAGLFLALLRLYGPKPLAVLAVGYIDLFRAIPILVLLVL 78 Query: 68 IFYGGQDLLNRVAPMFGYDDYIDLNPLAAGIGTLGFIFGAYLSETFRGAFMAIPKGQAEA 127 I+Y P G I L+P AA L + AY +E FR A+P+GQ EA Sbjct: 79 IYYA--------LPFVG----IRLSPFAAATSALSLVSCAYAAEIFRSGIQAVPRGQFEA 126 Query: 128 GMAYGMSSFQVFFRVLVPQMIRLAIPGFTNNWLVLTKATALISVVGLQDMMFKAKQAADA 187 A G+ + + + V++PQ RL IP TNN + + K TAL SVV + D++ +A QA Sbjct: 127 SQALGLKFWGMMWHVVLPQAFRLVIPPITNNCINVMKDTALASVVAMPDLLKQATQAQAL 186 Query: 188 TREPFTFFLAVAAMYLVITSVSLLALRHLEKRYSVGVR 225 P T + A +YL++ + + LEKR+++G R Sbjct: 187 AANP-TPLIGAAVIYLLLLLPMVRIVGSLEKRFAIGHR 223 Lambda K H 0.329 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 224 Length adjustment: 22 Effective length of query: 207 Effective length of database: 202 Effective search space: 41814 Effective search space used: 41814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory