Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_037448405.1 N825_RS06450 amino acid ABC transporter ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_000576635.1:WP_037448405.1 Length = 258 Score = 227 bits (579), Expect = 2e-64 Identities = 126/264 (47%), Positives = 173/264 (65%), Gaps = 12/264 (4%) Query: 13 VDEPVAQPVTAAIKLQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCI 72 V + VA V I +Q+ +HK YGE VLKG++L +G+ I + G SGSGKST++RCI Sbjct: 4 VRQTVAPQVGDDIAVQLSDVHKWYGEFHVLKGINLTVSRGERIVICGPSGSGKSTLIRCI 63 Query: 73 NFLEQPDAGVITLDGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLEN 132 N LE+ G I +DG+ + + + +R + MVFQHFNL+ H+TVLEN Sbjct: 64 NRLEEHQRGNIVVDGVEL----------TNNLKNIDQVRRDVGMVFQHFNLFPHLTVLEN 113 Query: 133 ITMAPRRVLDVSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPE 192 T+AP V + +AE A YL++V +P + A +YP LSGGQQQRVAIAR+L M P+ Sbjct: 114 CTLAPIWVRKMPKDQAEAVAMKYLERVRIPDQ-ARKYPGQLSGGQQQRVAIARSLCMNPK 172 Query: 193 IILFDEPTSALDPELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGR-VE 251 ++LFDEPTSALDPE++ EVL V+ LA EG TML VTHEMGFA+ V+++V+F+ +G VE Sbjct: 173 VMLFDEPTSALDPEMIKEVLDVMIGLAREGMTMLCVTHEMGFAKTVANRVIFMDRGEIVE 232 Query: 252 EHGDARILDQPNSERLQQFLSNRL 275 ++ + P SER + FLS L Sbjct: 233 QNAPNEFFNNPQSERTKLFLSQIL 256 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 258 Length adjustment: 25 Effective length of query: 251 Effective length of database: 233 Effective search space: 58483 Effective search space used: 58483 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory