Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_051511581.1 N825_RS05320 ABC transporter permease
Query= uniprot:D8J112 (347 letters) >NCBI__GCF_000576635.1:WP_051511581.1 Length = 338 Score = 206 bits (524), Expect = 7e-58 Identities = 119/307 (38%), Positives = 192/307 (62%), Gaps = 15/307 (4%) Query: 42 SLLLMILFFSFASPNFMEVDNLVSILQSTAVNGVLAIACTYVIITSGIDLSVGTMMTFCA 101 +L+++++ S SP F+ N+ ++L+ + G++AI TYVI+ GIDLSVG+++ A Sbjct: 44 ALIVILVVASLLSPYFLSTRNIFNVLRGATMVGIVAIGMTYVILNRGIDLSVGSLVGLSA 103 Query: 102 VMAGVVLTNWGMPLPLGIAAAIFF--GALSGWISGMVIAKLKVPPFIATLGMMMLLKGLS 159 + ++G +GIAA+I G + G +G++I KL++ PFIATLGMM+ +GL Sbjct: 104 ALTAS-FADYG----IGIAASIGLVSGLVLGLANGLMITKLRLQPFIATLGMMIFARGLV 158 Query: 160 LVIS-GTRPIYFNDTEGFSAIAQDSLIGDLIPSLPIPNAVLILFLVAIGASIILNKTVFG 218 V + G+ + T+ F+ + + IG P+P V++ L+ +++L TVFG Sbjct: 159 FVYTNGSNIVVDKPTDAFTWLGS-AYIG------PVPVPVVVFVLIWALCALVLRYTVFG 211 Query: 219 RYTFALGSNEEALRLSGVKVDFWKVAVYTFSGAICGIAGLIIASRLNSAQPALGQGYELD 278 R FA+G+NEEA RLSG+ VD K+ VY SG + AG+I+ASRL +P G +ELD Sbjct: 212 REIFAVGANEEAARLSGINVDRNKIRVYCISGVLAAFAGVIMASRLTVGEPNGGTLFELD 271 Query: 279 AIAAVVIGGTSLSGGTGTILGTIIGAFIMSVLVNGLRIMSVAQEWQTVVTGVIIILAVYL 338 AIAA +IGGT+ GG G++ GT++G I++ L N L +++++ Q ++ GVII+LAV + Sbjct: 272 AIAATLIGGTTFDGGVGSVHGTVLGVLILAFLSNVLNLLNISPYSQMLLKGVIIVLAVVV 331 Query: 339 DILRRRR 345 R+R+ Sbjct: 332 SEWRKRK 338 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 338 Length adjustment: 29 Effective length of query: 318 Effective length of database: 309 Effective search space: 98262 Effective search space used: 98262 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory