Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate WP_037449677.1 N825_RS08300 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >NCBI__GCF_000576635.1:WP_037449677.1 Length = 358 Score = 340 bits (873), Expect = 3e-98 Identities = 180/367 (49%), Positives = 242/367 (65%), Gaps = 11/367 (2%) Query: 1 MATLELRNVNKTYGPGLPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGG 60 MA + +R V KTY G + +K I+ + DGEFL+++GPSGCGKSTL+ +AGLETIS G Sbjct: 1 MAEVGIRGVRKTYAGGF-EAIKGIDCAVGDGEFLVMLGPSGCGKSTLLRMVAGLETISAG 59 Query: 61 AILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVS 120 + + ++ + PKDRDIAMVFQ+YALYP M+V DN+A+GLKIR M A+I+ V + S Sbjct: 60 EVSIGGRVVNDLEPKDRDIAMVFQNYALYPHMTVYDNMAYGLKIRGMSKADIESRVHKAS 119 Query: 121 KLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 +L++ L R+P QLSGGQ+QRVAMGRA+ R PK++LFDEPLSNLDAKLR +MR E+ Sbjct: 120 DILELRPFLDRRPRQLSGGQRQRVAMGRAIVREPKVFLFDEPLSNLDAKLRTQMRVEINR 179 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSPP 240 + RL T++YVTHDQ+EAMTL D++ VM G+ +Q GTP ++Y+ PA+ FVA FIGSP Sbjct: 180 LQDRLGITSLYVTHDQVEAMTLADRMMVMNGGVAEQIGTPMEVYHRPASTFVAGFIGSPA 239 Query: 241 MNFIPLRLQRKDGRLLALLDSGQARCELPLGMQDAGLEDREVILGIRPEQIILANGEANG 300 MNF+P RL L +G LP G A RE+ LGIRPE + L +G+ G Sbjct: 240 MNFLPARLTASGVEL-----NGGHAVPLPAGSGGASAA-REITLGIRPEHLTLESGQ--G 291 Query: 301 LPTIRAEVQVTEPTGPDTLVFVNLNDT--KVCCRLAPDVAPAVGETLTLQFDPAKVLLFD 358 + I +V++ E G DT+V L + + RL + G+TL P +V LFD Sbjct: 292 IGDIAVKVELIEALGADTVVHARLTSSGDPLLARLPGSARVSNGDTLHFAITPGEVHLFD 351 Query: 359 AKTGERL 365 +TG RL Sbjct: 352 RQTGRRL 358 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 358 Length adjustment: 30 Effective length of query: 356 Effective length of database: 328 Effective search space: 116768 Effective search space used: 116768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory