Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_051512736.1 N825_RS21345 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000576635.1:WP_051512736.1 Length = 378 Score = 224 bits (571), Expect = 3e-63 Identities = 114/251 (45%), Positives = 168/251 (66%), Gaps = 3/251 (1%) Query: 3 RIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGEL 62 R+++KN+ K K G A++ +++++ GE +LGPSG GKTT +R++AG P GE+ Sbjct: 19 RLLIKNLKK--KLGDTAAVNGIDLSVRPGESVVLLGPSGCGKTTTLRMVAGFLTPDGGEI 76 Query: 63 YFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVE 122 + D +LV+S + PPE R +GMVFQT+A++P++ +N+ + L +++I + V Sbjct: 77 HLDGKLVSS-ATVSAPPERRNLGMVFQTYAVWPHMKVADNVGYGLKVAGGKRDDIAREVA 135 Query: 123 EVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARAL 182 + I+ + H+ +P ELSGGQQQRVALARALV PSLLLLDEP SNLDA +R R Sbjct: 136 RILDIVQLGHLAGRYPAELSGGQQQRVALARALVTRPSLLLLDEPLSNLDAALRQEMRYE 195 Query: 183 VKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIG 242 +KE+ +R+G+T L V+HD + +ADR+ VL KG++ QVG P+++Y P S VAS IG Sbjct: 196 LKELHTRIGITTLYVTHDQDEALVLADRIVVLDKGRIEQVGTPQEIYRRPASRFVASFIG 255 Query: 243 EINELEGKVTN 253 N LEG V+N Sbjct: 256 TANLLEGAVSN 266 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 378 Length adjustment: 30 Effective length of query: 323 Effective length of database: 348 Effective search space: 112404 Effective search space used: 112404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory