Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_084164990.1 N825_RS22885 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_000576635.1:WP_084164990.1 Length = 377 Score = 221 bits (564), Expect = 2e-62 Identities = 137/360 (38%), Positives = 211/360 (58%), Gaps = 23/360 (6%) Query: 6 VKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD 65 ++ V+K F G V A+ +VN+++E G+ G+LGPSG GKTT +R+IAGL ++G + D Sbjct: 28 LEGVTKRFA-GDVNAVSDVNLDLERGKLLGLLGPSGCGKTTTLRMIAGLLPITSGRILVD 86 Query: 66 DRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVA 125 D ++ + PP R G+VFQ +AL+P++T EN+AF L ++ K E R+RV E Sbjct: 87 DDDIS-----LRPPHQRDFGLVFQNYALFPHMTVAENVAFGLDMRRVPKAEARRRVAEAL 141 Query: 126 KILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKE 185 +++ + PRE+SGGQQQRVALARALV +P +LLLDEP SNLDA++RD R ++E Sbjct: 142 ELVRLPGYGERKPREMSGGQQQRVALARALVINPRILLLDEPLSNLDAKLRDEMRREIRE 201 Query: 186 VQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEIN 245 +Q RLG+T + V+HD + + D VGV+ G+L Q+G PED+Y+ P S+ VA +G N Sbjct: 202 IQQRLGITTVFVTHDQVEALTMCDVVGVMSGGRLAQIGTPEDIYERPASLFVADFVGRTN 261 Query: 246 ELEGKVTN-EGVVIGSLRFPVSVSSDR---AIIGIRPEDVKLS--KDVIKDDSWILVGKG 299 L+ +V N V +G + + ++ R A + IRP + L+ +D + +G Sbjct: 262 ILDCEVLNGHRVRLGDGVYSCAATTIRPGKAKVAIRPHRINLTPHRDRALLSTSTNSAEG 321 Query: 300 KVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHS-------GEEVLVYVRKDKIKVFEK 352 +V Y G + + I ++ T P H G+++L R D + VFE+ Sbjct: 322 RVLRTTYVGDIVQYDIDIGGPTLQVET----PTHGRGLAVAVGDKLLCEWRPDDMLVFER 377 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 377 Length adjustment: 30 Effective length of query: 323 Effective length of database: 347 Effective search space: 112081 Effective search space used: 112081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory