Align MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized)
to candidate WP_051511581.1 N825_RS05320 ABC transporter permease
Query= TCDB::P23200 (336 letters) >NCBI__GCF_000576635.1:WP_051511581.1 Length = 338 Score = 181 bits (460), Expect = 2e-50 Identities = 115/330 (34%), Positives = 175/330 (53%), Gaps = 30/330 (9%) Query: 2 SALNKKSFLTYLKEGGIYVVLLVLLAIIIFQDPTFLSLLNLSNILTQSSVRIIIALGVAG 61 S++N FL + L+V+L + P FLS N+ N+L +++ I+A+G+ Sbjct: 28 SSINWTRFLVQYSN---VLALIVILVVASLLSPYFLSTRNIFNVLRGATMVGIVAIGMTY 84 Query: 62 LIVTQGTDLSAGRQVGLAAVVAATLLQSMDNANKVFPEMATMPIALVILIVCAIGAVIGL 121 +I+ +G DLS G VGL+A + A+ A I + I G V+GL Sbjct: 85 VILNRGIDLSVGSLVGLSAALTASF--------------ADYGIGIAASIGLVSGLVLGL 130 Query: 122 INGLIIAYLNVTPFITTLGTMIIVYGINSLYYDFVGASPISGFDSGFSTFAQGFVALGSF 181 NGL+I L + PFI TLG MI G+ +Y +G + F LGS Sbjct: 131 ANGLMITKLRLQPFIATLGMMIFARGLVFVY--------TNGSNIVVDKPTDAFTWLGSA 182 Query: 182 RLSYITFYALIAVAFVWVLW----NKTRFGKNIFAIGGNPEAAKVSGVNVGLNLLMIYAL 237 + + ++ V +W L T FG+ IFA+G N EAA++SG+NV N + +Y + Sbjct: 183 YIGPVPVPVVVFV-LIWALCALVLRYTVFGREIFAVGANEEAARLSGINVDRNKIRVYCI 241 Query: 238 SGVFYAFGGMLEAGRIGSATNNLGFMYELDAIAACVVGGVSFSGGVGTVIGVVTGVIIFT 297 SGV AF G++ A R+ N G ++ELDAIAA ++GG +F GGVG+V G V GV+I Sbjct: 242 SGVLAAFAGVIMASRLTVGEPNGGTLFELDAIAATLIGGTTFDGGVGSVHGTVLGVLILA 301 Query: 298 VINYGLTYIGVNPYWQYIIKGAIIIFAVAL 327 ++ L + ++PY Q ++KG II+ AV + Sbjct: 302 FLSNVLNLLNISPYSQMLLKGVIIVLAVVV 331 Lambda K H 0.327 0.143 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 338 Length adjustment: 28 Effective length of query: 308 Effective length of database: 310 Effective search space: 95480 Effective search space used: 95480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory