Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate WP_037450702.1 N825_RS10350 sugar ABC transporter permease YjfF
Query= SwissProt::P37772 (331 letters) >NCBI__GCF_000576635.1:WP_037450702.1 Length = 327 Score = 379 bits (973), Expect = e-110 Identities = 194/313 (61%), Positives = 238/313 (76%) Query: 2 IKRNLPLMITIGVFVLGYLYCLTQFPGFASTRVICNILTDNAFLGIIAVGMTFVILSGGI 61 + R LP+++T VF++G++ C Q+P FASTRV+ N+LTDNAFLGI+AVGMTFVI+SGGI Sbjct: 1 MNRLLPVLVTTAVFLVGFIICSLQYPNFASTRVVANLLTDNAFLGIVAVGMTFVIISGGI 60 Query: 62 DLSVGSVIAFTGVFLAKVIGDFGLSPLLAFPLVLVMGCAFGAFMGLLIDALKIPAFIITL 121 DLSVGSVI FT VFLA I + PL+AF LVLV+ AFGA MG I +P FI+TL Sbjct: 61 DLSVGSVIGFTTVFLALAIERHDVPPLVAFALVLVICAAFGAAMGAAIQYFDLPPFIVTL 120 Query: 122 AGMFFLRGVSYLVSEESIPINHPIYDTLSSLAWKIPGGGRLSAMGLLMLAVVVIGIFLAH 181 AG+F RG S+L+S ESI IN P+Y ++ A ++PGGGRL+ + L+MLAV V G L H Sbjct: 121 AGLFLARGASFLMSTESIAINAPLYSDIAGYAIRLPGGGRLTIIALMMLAVFVAGGVLLH 180 Query: 182 RTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLATLAGIVFSIYTQAGYALAGV 241 TRFG VYA+GG+ S LMG+ +TTIRIYMLS+ LA L+GIVF+ YT AGY+L+ V Sbjct: 181 FTRFGTNVYALGGSRASTALMGVRVGATTIRIYMLSSVLAGLSGIVFTFYTSAGYSLSAV 240 Query: 242 GVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTKIAIGILL 301 GVELD IA+VVIGGT+L+GG G V GT GV IQGLIQTYI FDG+LSSWWTKIA G+LL Sbjct: 241 GVELDTIAAVVIGGTMLTGGYGFVFGTFVGVLIQGLIQTYITFDGSLSSWWTKIATGVLL 300 Query: 302 FIFIALQRGLTVL 314 F FIA Q+ L VL Sbjct: 301 FAFIAFQQLLVVL 313 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 327 Length adjustment: 28 Effective length of query: 303 Effective length of database: 299 Effective search space: 90597 Effective search space used: 90597 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory