Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate WP_037452166.1 N825_RS13095 ribose ABC transporter permease
Query= SwissProt::P37772 (331 letters) >NCBI__GCF_000576635.1:WP_037452166.1 Length = 338 Score = 154 bits (388), Expect = 4e-42 Identities = 110/315 (34%), Positives = 172/315 (54%), Gaps = 18/315 (5%) Query: 3 KRNLPLMI-TIGVFVLGYLYCLT-QFPG--FASTRVICNILTDNAFLGIIAVGMTFVILS 58 K+NL +I +G+ + L C+ +F F + R I ++ + ++A G+TFVIL+ Sbjct: 25 KQNLHTIIQVVGMLPVLILICIGFEFATGKFLTARNISIVMQQASINIVLATGLTFVILT 84 Query: 59 GGIDLSVGSVIAFTGVFLAKVIGDFGLSPLLAFPLVLVMGCAFGAFMGLLIDALKIPAFI 118 GGIDL+VG+V+A + V + P LA PL L++G A GA G LI ++P FI Sbjct: 85 GGIDLAVGAVLAVSAVTAVSMT--LTGMPDLAIPLALLVGLALGAVNGSLIAFFRLPPFI 142 Query: 119 ITLAGMFFLRGVSYLVSEESIPINHPIYDTLSSLAWKIPGGGRLSA---MGLLMLAVVVI 175 +TL M +RG+S L + ++ +++ AW G +L M ++ LAVV I Sbjct: 143 VTLGAMTAVRGLSRLSANDTT-----VFNAALPFAWI--GNSQLFGIPWMVIIALAVVAI 195 Query: 176 GIFLAHRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGLATLAGIVFSIYT-QA 234 F+ RT G +Y +GGN +A L GI + + +Y +S LA LAG++ + T A Sbjct: 196 SWFVLRRTVLGVWIYGVGGNPDAARLSGIKVWAVLLFVYAISGMLAGLAGVMSAARTLSA 255 Query: 235 GYALAGVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTK 294 A G+G ELDAIA+V++GGT GG+G++ GTL G I ++ + +S W Sbjct: 256 NGAQLGMGYELDAIAAVILGGTSFVGGIGSIFGTLIGALIIAVLSNGLIL-MNVSEVWQL 314 Query: 295 IAIGILLFIFIALQR 309 I G+++ +AL R Sbjct: 315 IIKGLVIVGAVALDR 329 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 338 Length adjustment: 28 Effective length of query: 303 Effective length of database: 310 Effective search space: 93930 Effective search space used: 93930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory