Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate WP_051511581.1 N825_RS05320 ABC transporter permease
Query= SwissProt::P39328 (341 letters) >NCBI__GCF_000576635.1:WP_051511581.1 Length = 338 Score = 167 bits (424), Expect = 3e-46 Identities = 110/332 (33%), Positives = 183/332 (55%), Gaps = 16/332 (4%) Query: 1 MMPQSLPDTTTPKRRFRWPTGMPQ---LVALLLVLLVDSLVAPHFWQVVLQDGRLFGSPI 57 + P S T W + Q ++AL+++L+V SL++P+F L +F Sbjct: 15 LAPSSKMGAQTGASSINWTRFLVQYSNVLALIVILVVASLLSPYF----LSTRNIF---- 66 Query: 58 DILNRAAPVALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVAGFSLPIVLLSALGT 117 ++L A V ++AIGMT VI GIDLSVG+++ ++ A TA+ A + + I L + Sbjct: 67 NVLRGATMVGIVAIGMTYVILNRGIDLSVGSLVGLSAALTASF--ADYGIGIAASIGLVS 124 Query: 118 GILAGLWNGILVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPD--LSWFGSGSL 175 G++ GL NG+++ L++QPF+ATL +M+ RG+ + T G + + P +W GS + Sbjct: 125 GLVLGLANGLMITKLRLQPFIATLGMMIFARGLVFVYTNGSNIVVDKPTDAFTWLGSAYI 184 Query: 176 LFLPTPVIIAVLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGL 235 +P PV++ VL L L+ R T G I AVG N AA+ +G+N + Y +SG+ Sbjct: 185 GPVPVPVVVFVLIWALCALVLRYTVFGREIFAVGANEEAARLSGINVDRNKIRVYCISGV 244 Query: 236 CAAIAGIIVAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGM 295 AA AG+I+A+ + + N G ELDAI A +IGG + GG ++ +V+G LI+ + Sbjct: 245 LAAFAGVIMASRLTVGEP-NGGTLFELDAIAATLIGGTTFDGGVGSVHGTVLGVLILAFL 303 Query: 296 NTGILLSGFPPEMNQVVKAVVVLCVLIVQSQR 327 + + L P ++K V+++ ++V R Sbjct: 304 SNVLNLLNISPYSQMLLKGVIIVLAVVVSEWR 335 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 338 Length adjustment: 28 Effective length of query: 313 Effective length of database: 310 Effective search space: 97030 Effective search space used: 97030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory