Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate WP_037454066.1 N825_RS16590 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b21219 (281 letters) >NCBI__GCF_000576635.1:WP_037454066.1 Length = 283 Score = 145 bits (367), Expect = 7e-40 Identities = 89/273 (32%), Positives = 144/273 (52%), Gaps = 9/273 (3%) Query: 14 ASALLLAVVILA----PVAWLLIMSISPAADLSAKPLAWWPSDIDLSRYRTLLSAVENSA 69 A LL+ + +L P+ L++ +ISP + L WP + L ++ +L+ ++ Sbjct: 13 AKLLLIGIPVLLWTLLPIYHLVLFAISPRDTAFSGKL--WPDEPTLRNFQIVLNQ-DHYF 69 Query: 70 GAAFIASLLNSIKVAGMATLAAVVVAVPAAWAVSRTPAVAWSLYAVIA--TYMLPPVALA 127 F L NS+ +A + +++A AA+A+SR +A TY +P LA Sbjct: 70 LIHFWEQLANSLIIAVSTGVLTLLIATFAAFAISRLKVEGGRTVMNLALFTYFIPAAFLA 129 Query: 128 VPLYMGLAYFGLLNSVFGLALVYLTILAPFTTWLLKSGFDSIPREIESAAMIDGARLDQI 187 VP+Y + +GLLNS + L L +T+ P+ W+LK D +P E++ AA++DGA Q+ Sbjct: 130 VPMYRTMGVYGLLNSKWALILAMVTVATPYAIWVLKQASDKLPYELDEAAVVDGASPMQL 189 Query: 188 LRILTLPLAAPVMATSALFAFLLAWDEFFYALLFTSDQRAKTLTVAIADLAGGRVSDYGL 247 ++ LPL P + +A LLAW+E+ YA L S TL VA+ + S + L Sbjct: 190 FWMVYLPLMKPSLVAVGTYALLLAWNEYLYAFLLLSRDTEITLPVALGNFLSADDSPWEL 249 Query: 248 IATAGVLAALPPVLIGLIMQRALISGLTSGGVK 280 + T G++ ALPP I +R ++ GLT+G VK Sbjct: 250 LMTTGLIYALPPAAIYYTFKRYMVGGLTAGAVK 282 Lambda K H 0.325 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 283 Length adjustment: 26 Effective length of query: 255 Effective length of database: 257 Effective search space: 65535 Effective search space used: 65535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory