Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_037449677.1 N825_RS08300 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= reanno::Smeli:SMc02869 (352 letters) >NCBI__GCF_000576635.1:WP_037449677.1 Length = 358 Score = 330 bits (847), Expect = 3e-95 Identities = 184/346 (53%), Positives = 231/346 (66%), Gaps = 25/346 (7%) Query: 22 LKTIRKAF-GSHEVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGSVQIDG 80 ++ +RK + G E +KGID V DGEF++ +GPSGCGKSTLLR +AGLE ++G V I G Sbjct: 6 IRGVRKTYAGGFEAIKGIDCAVGDGEFLVMLGPSGCGKSTLLRMVAGLETISAGEVSIGG 65 Query: 81 VEVGHVAPAKRGIAMVFQSYALYPHLTVKDNMGLGLKQAGVPKAEIEEKVAKAAGMLSLE 140 V + P R IAMVFQ+YALYPH+TV DNM GLK G+ KA+IE +V KA+ +L L Sbjct: 66 RVVNDLEPKDRDIAMVFQNYALYPHMTVYDNMAYGLKIRGMSKADIESRVHKASDILELR 125 Query: 141 PYLARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIARLHRSLK 200 P+L RRP +LSGGQRQRVA+GRAIVREPK+FLFDEPLSNLDA LR R+EI RL L Sbjct: 126 PFLDRRPRQLSGGQRQRVAMGRAIVREPKVFLFDEPLSNLDAKLRTQMRVEINRLQDRLG 185 Query: 201 ATMIYVTHDQVEAMTLADKIVVLNAGRIEQVGSPMELYNRPANLFVAGFIGSPQMNFIEA 260 T +YVTHDQVEAMTLAD+++V+N G EQ+G+PME+Y+RPA+ FVAGFIGSP MNF+ A Sbjct: 186 ITSLYVTHDQVEAMTLADRMMVMNGGVAEQIGTPMEVYHRPASTFVAGFIGSPAMNFLPA 245 Query: 261 ------AKLGDGEAK---------------TIGIRPEHIGL--SRESGDWKGKVIHVEHL 297 +L G A T+GIRPEH+ L + GD KV +E L Sbjct: 246 RLTASGVELNGGHAVPLPAGSGGASAAREITLGIRPEHLTLESGQGIGDIAVKVELIEAL 305 Query: 298 GADTIIYIESETVG-LLTVRLFGEHRYATDDIVHATPVIGSMHRFD 342 GADT+++ + G L RL G R + D +H G +H FD Sbjct: 306 GADTVVHARLTSSGDPLLARLPGSARVSNGDTLHFAITPGEVHLFD 351 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 358 Length adjustment: 29 Effective length of query: 323 Effective length of database: 329 Effective search space: 106267 Effective search space used: 106267 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory