Align ABC transporter related (characterized, see rationale)
to candidate WP_037448405.1 N825_RS06450 amino acid ABC transporter ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >NCBI__GCF_000576635.1:WP_037448405.1 Length = 258 Score = 229 bits (585), Expect = 3e-65 Identities = 120/249 (48%), Positives = 169/249 (67%), Gaps = 11/249 (4%) Query: 7 VALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVS 66 +A+ + ++HK +G+ HVLKGI+L +G+ I I G SGSGKST +RC+N LE G++ Sbjct: 16 IAVQLSDVHKWYGEFHVLKGINLTVSRGERIVICGPSGSGKSTLIRCINRLEEHQRGNIV 75 Query: 67 LAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKR 126 + G EL ++ + +D+VR +GMVFQ+FNL+ H+TVLEN P+ V+K Sbjct: 76 VDGVELT-----------NNLKNIDQVRRDVGMVFQHFNLFPHLTVLENCTLAPIWVRKM 124 Query: 127 SRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALD 186 + ++ A L +V + ++ YP LSGGQQQRVAIAR+L M+PKVMLFDEPTSALD Sbjct: 125 PKDQAEAVAMKYLERVRIPDQARKYPGQLSGGQQQRVAIARSLCMNPKVMLFDEPTSALD 184 Query: 187 PELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFVECK 246 PE++ EVL VM LA EG TML VTHEMGFA+ V+NRV+F+ +G++ P+E F + Sbjct: 185 PEMIKEVLDVMIGLAREGMTMLCVTHEMGFAKTVANRVIFMDRGEIVEQNAPNEFFNNPQ 244 Query: 247 SDRFRQFVS 255 S+R + F+S Sbjct: 245 SERTKLFLS 253 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 258 Length adjustment: 25 Effective length of query: 238 Effective length of database: 233 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory