Align ABC transporter related (characterized, see rationale)
to candidate WP_037453109.1 N825_RS14315 ATP-binding cassette domain-containing protein
Query= uniprot:B2TBJ9 (263 letters) >NCBI__GCF_000576635.1:WP_037453109.1 Length = 250 Score = 234 bits (598), Expect = 1e-66 Identities = 128/241 (53%), Positives = 161/241 (66%), Gaps = 1/241 (0%) Query: 14 IHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVSLAGEELK 73 + KSFG VL GI + +V+ +LG SGSGKST LRC+N LE G + + GE + Sbjct: 7 VRKSFGAVEVLSGIDMTILPREVVCLLGPSGSGKSTLLRCINHLEKLSGGRILVDGELIG 66 Query: 74 MKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKRSRAESVE 133 + RGD +L ++ R R +GMVFQ FNL+ H+ V+ N+ + PM ++ SRAE+ Sbjct: 67 YRERGD-RLHELGSAELARQRRDIGMVFQRFNLFPHLDVVGNITQAPMLIKGESRAEATR 125 Query: 134 EAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALDPELVGEV 193 A LL V LA K YP LSGGQQQRVAIARALAM PK+MLFDEPTSALDPELVGEV Sbjct: 126 RAHELLEIVDLAGKANAYPHQLSGGQQQRVAIARALAMRPKLMLFDEPTSALDPELVGEV 185 Query: 194 LRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFVECKSDRFRQF 253 L VM+ LA EG TMLVVTHEMGFAR V++RV+F+ +G V GT +V + DR + F Sbjct: 186 LAVMKRLALEGMTMLVVTHEMGFAREVADRVIFMDRGVVVEQGTAADVIARPRHDRTKAF 245 Query: 254 V 254 + Sbjct: 246 L 246 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 250 Length adjustment: 24 Effective length of query: 239 Effective length of database: 226 Effective search space: 54014 Effective search space used: 54014 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory