Align ABC transporter related (characterized, see rationale)
to candidate WP_051511316.1 N825_RS00145 ABC transporter ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >NCBI__GCF_000576635.1:WP_051511316.1 Length = 269 Score = 330 bits (847), Expect = 1e-95 Identities = 165/248 (66%), Positives = 203/248 (81%), Gaps = 1/248 (0%) Query: 8 ALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVSL 67 A+ V+++HK FG VLKG+SL AH+GDVIS++G+SGSGKSTFLRC+NLLETPD+G V + Sbjct: 20 AVVVEDLHKRFGQLEVLKGVSLVAHEGDVISMIGSSGSGKSTFLRCINLLETPDEGRVWV 79 Query: 68 AGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKRS 127 GE ++MK+ G P+D +QVDR+RS LGMVFQ FNLW+HMTVL+N+IE P+ V Sbjct: 80 NGELIRMKQ-GRHHAVPADAKQVDRIRSGLGMVFQGFNLWTHMTVLQNVIEAPVHVLGVP 138 Query: 128 RAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALDP 187 +AE+++ AEALL KVGL K YP+HLSGGQQQRVAIARALAM PKVMLFDEPTSALDP Sbjct: 139 KAEAIDRAEALLQKVGLEAKASSYPSHLSGGQQQRVAIARALAMQPKVMLFDEPTSALDP 198 Query: 188 ELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFVECKS 247 ELVGEVLRVMR LA+EG TM++VTHEMGFAR VS+ V+FLHQG++E G PD+V +S Sbjct: 199 ELVGEVLRVMRQLADEGMTMIIVTHEMGFAREVSSEVIFLHQGRIEEQGPPDQVLANPRS 258 Query: 248 DRFRQFVS 255 DR RQF++ Sbjct: 259 DRCRQFLA 266 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 269 Length adjustment: 25 Effective length of query: 238 Effective length of database: 244 Effective search space: 58072 Effective search space used: 58072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory