Align ABC transporter related (characterized, see rationale)
to candidate WP_157619653.1 N825_RS30520 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
Query= uniprot:B2TBJ9 (263 letters) >NCBI__GCF_000576635.1:WP_157619653.1 Length = 258 Score = 232 bits (592), Expect = 5e-66 Identities = 129/248 (52%), Positives = 165/248 (66%), Gaps = 5/248 (2%) Query: 12 KNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVSLAGEE 71 K I K+FG VL + LD + ++++G SGSGKST LR L LE PD GS+ + G Sbjct: 5 KGISKAFGSLTVLDNLDLDIAPAEKVALIGPSGSGKSTLLRVLMTLERPDTGSIEIDGAP 64 Query: 72 L-KMKRRG---DGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKRS 127 L M +G +G L P+D + +R +GMVFQ FNL+ HMTVL N+ E P+ V Sbjct: 65 LWHMPGKGGAKNGGLVPADAGHLREMRKNVGMVFQQFNLFPHMTVLRNVTEAPVHVLGIG 124 Query: 128 RAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALDP 187 + E+ A LL VGL +K GHYPA LSGGQQQRVAIARALAM P+VMLFDE TSALDP Sbjct: 125 KDEAEARARDLLELVGLRDKLGHYPAQLSGGQQQRVAIARALAMRPRVMLFDEVTSALDP 184 Query: 188 ELVGEVLRVMRSLAEE-GRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFVECK 246 E VGEVL V+R LAEE TML+VTH+MGFAR ++RV F +QG++ G PD++F + Sbjct: 185 ETVGEVLNVIRKLAEEHNLTMLMVTHQMGFAREFADRVCFFYQGRICEQGPPDQLFNHPR 244 Query: 247 SDRFRQFV 254 +R + F+ Sbjct: 245 EERTQAFL 252 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 258 Length adjustment: 25 Effective length of query: 238 Effective length of database: 233 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory