Align AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_051511316.1 N825_RS00145 ABC transporter ATP-binding protein
Query= TCDB::Q52815 (257 letters) >NCBI__GCF_000576635.1:WP_051511316.1 Length = 269 Score = 232 bits (591), Expect = 7e-66 Identities = 122/262 (46%), Positives = 173/262 (66%), Gaps = 10/262 (3%) Query: 5 PAKKLTVSATEVAVEIVNMNKWYGDFHVLRDINLKVMRGERIVIAGPSGSGKSTMIRCIN 64 PA ++ AV + +++K +G VL+ ++L G+ I + G SGSGKST +RCIN Sbjct: 8 PANQIPSPVPGAAVVVEDLHKRFGQLEVLKGVSLVAHEGDVISMIGSSGSGKSTFLRCIN 67 Query: 65 RLEEHQKGKIVVDGT----------ELTNDLKKIDEVRREVGMVFQHFNLFPHLTILENC 114 LE +G++ V+G + D K++D +R +GMVFQ FNL+ H+T+L+N Sbjct: 68 LLETPDEGRVWVNGELIRMKQGRHHAVPADAKQVDRIRSGLGMVFQGFNLWTHMTVLQNV 127 Query: 115 TLAPIWVRKMPKKQAEEVAMHFLKRVKIPEQANKYPGQLSGGQQQRVAIARSLCMNPKIM 174 AP+ V +PK +A + A L++V + +A+ YP LSGGQQQRVAIAR+L M PK+M Sbjct: 128 IEAPVHVLGVPKAEAIDRAEALLQKVGLEAKASSYPSHLSGGQQQRVAIARALAMQPKVM 187 Query: 175 LFDEPTSALDPEMIKEVLDTMVGLAEEGMTMLCVTHEMGFARQVANRVIFMDQGQIVEQN 234 LFDEPTSALDPE++ EVL M LA+EGMTM+ VTHEMGFAR+V++ VIF+ QG+I EQ Sbjct: 188 LFDEPTSALDPELVGEVLRVMRQLADEGMTMIIVTHEMGFAREVSSEVIFLHQGRIEEQG 247 Query: 235 EPAAFFDNPQHERTKLFLSQIL 256 P NP+ +R + FL++ L Sbjct: 248 PPDQVLANPRSDRCRQFLARNL 269 Lambda K H 0.321 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 269 Length adjustment: 25 Effective length of query: 232 Effective length of database: 244 Effective search space: 56608 Effective search space used: 56608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory