Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_037454055.1 N825_RS16570 2-hydroxyacid dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000576635.1:WP_037454055.1 Length = 325 Score = 156 bits (395), Expect = 6e-43 Identities = 98/279 (35%), Positives = 149/279 (53%), Gaps = 14/279 (5%) Query: 30 TQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLA 89 T+H A + + G + +++ L+ + VG+DQ D GIV+ Sbjct: 40 TEHGARIRGV-----AAGGHAGVDESLMARLPTLEIIGAFGVGYDQIDAKWAGEHGIVVT 94 Query: 90 NTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGL 149 NTPDVLT+ AD L+L++ R++ ++ G W P ++G+ +GI+GL Sbjct: 95 NTPDVLTDEVADLTIGLLLSTVRQIPGAERHLREGKWPAGNYPLT--ASLRGRKVGILGL 152 Query: 150 GRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTPE 209 GRIG A+A+R F + + Y R E Y A VELA + D + +P Sbjct: 153 GRIGKAIAKRLQ-AFGLPISYYGRHKQDGVEFPYVADPVELARQV---DILISVLPGGAA 208 Query: 210 TKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEP-LPSDS 268 T+ LIG+A +++ + +N RG+ VDE ALIEAL++ TI GAG+DVF EP +P++ Sbjct: 209 TEKLIGSAVFEALGSDGVFVNVGRGSVVDEAALIEALRSKTILGAGIDVFADEPNVPAE- 267 Query: 269 PLLKLANVVALPHIGSATHETRHAMARNAAENLVAALDG 307 L+ N V LPH+ SAT TR+AM + +NLV+ DG Sbjct: 268 -LIARENAVLLPHVASATVHTRNAMGQLVVDNLVSWFDG 305 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 325 Length adjustment: 28 Effective length of query: 293 Effective length of database: 297 Effective search space: 87021 Effective search space used: 87021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory