Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate WP_037460635.1 N825_RS31785 carbohydrate ABC transporter permease
Query= uniprot:A8LLL4 (385 letters) >NCBI__GCF_000576635.1:WP_037460635.1 Length = 274 Score = 92.8 bits (229), Expect = 1e-23 Identities = 60/200 (30%), Positives = 105/200 (52%), Gaps = 7/200 (3%) Query: 188 ATIIPILVAAFAAYALAWMEFPGRALLIALIVGLLVVPLQLALIPLLTLHNAIGIGKGYL 247 +T + +L+ AAYA A E G+ L I+ + P +IP + IG+ + Sbjct: 79 STALVVLIGTPAAYAFARFEMRGKDDLFLFILASRMGPPVCLVIPFYLIFAKIGLIDTFA 138 Query: 248 GTWLAHTGFGMPLAIYLLRNYMVGLPRDIIENAKVDGATDFQIFTKIVLPLSFPALASFA 307 G LA+ F + +++LR++ LP ++ E A ++G + QIF ++V PL + + A Sbjct: 139 GLTLAYMTFNLSFYVWVLRSFCRDLPVELEEAAALEGWSRPQIFRRVVFPLLRNGIVATA 198 Query: 308 IFQFLWTWNDLLVAKVFLIDATGQTTVMTNQIV--ELLGTRGGNWEILATAAFVSIAVPL 365 + F++ WN+ L A F++ G TV T + +L+ ++G W +A V++ L Sbjct: 199 VLCFIFAWNEFLFA--FML---GGKTVQTLPVAIPKLITSQGVRWGEMAVVGIVALVPVL 253 Query: 366 LVFFSMQRFLVRGLLAGSVK 385 V ++QR +VRGL G+VK Sbjct: 254 AVVIALQRHIVRGLTLGAVK 273 Lambda K H 0.323 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 274 Length adjustment: 28 Effective length of query: 357 Effective length of database: 246 Effective search space: 87822 Effective search space used: 87822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory