Align gluconolactonase subunit (EC 3.1.1.17) (characterized)
to candidate WP_037452878.1 N825_RS14430 SMP-30/gluconolactonase/LRE family protein
Query= metacyc::MONOMER-13276 (356 letters) >NCBI__GCF_000576635.1:WP_037452878.1 Length = 313 Score = 146 bits (368), Expect = 8e-40 Identities = 94/293 (32%), Positives = 155/293 (52%), Gaps = 21/293 (7%) Query: 65 IEVIASDIQWSEGPVWVKNGNFLLFSDPPANIMRKWTPDAGVSIFLKPSGHAEPIPAGQF 124 +E + + ++W+EGPVW +GN+LL+SD P N M +W A P G A + + Sbjct: 25 LERLHTGMRWAEGPVWFGDGNYLLWSDIPNNRMMRWVSGA-------PEGGAVSV----Y 73 Query: 125 REPG--SNGMKVGPDGKIWVADSGTRAIMKVDPVTRQRSVVVDNYKGKRFNSPNDLFFSK 182 R+P SNG G++ + G R + + + +V+ D++KG+R NSPND+ Sbjct: 74 RDPSNNSNGNTRDRQGRLVTCEHGARRVTRTE-FDGTITVLADSHKGRRLNSPNDVVVKS 132 Query: 183 SGAVYFTDPPYGLTNLDESDIKEMNYNG--VFRLSPD-GRLDLIEAGLSRPNGLALSPDE 239 G+++FTDPPYG+ E EM +G V+R+ PD G L ++ +PNG+A SPDE Sbjct: 133 DGSIWFTDPPYGILTDYEGHKAEMEQDGCHVYRIDPDTGALTVVADDFDKPNGIAFSPDE 192 Query: 240 TKLYVSNSDRASPNIWVYSLDSNGLPTSRTLLRNFR-KEYFDQGLAGLPDGMNIDKQGNL 298 LYV+++ + + + + + TS TL F GL DG +D GN+ Sbjct: 193 HILYVADTGASHTPDGPHHIRAFDVSTSGTLSGGLSGGRIFATISPGLADGFRLDTDGNV 252 Query: 299 FASAPGGIYIFAPDGECLGLISGNPGQPLSNCCF-GEKGQTLFISASHNVVRV 350 + SA G++ ++ +G+ +G + + +SN F G K LFI+ + ++ V Sbjct: 253 WTSAGDGVHCYSSNGDLIGKVL--VPEVVSNVAFGGPKRNRLFITGTTSLYSV 303 Lambda K H 0.317 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 463 Number of extensions: 41 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 313 Length adjustment: 28 Effective length of query: 328 Effective length of database: 285 Effective search space: 93480 Effective search space used: 93480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory