Align Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_037460236.1 N825_RS30935 carbohydrate ABC transporter permease
Query= uniprot:A0A165KQ00 (289 letters) >NCBI__GCF_000576635.1:WP_037460236.1 Length = 288 Score = 106 bits (265), Expect = 5e-28 Identities = 83/281 (29%), Positives = 129/281 (45%), Gaps = 22/281 (7%) Query: 16 VYAVLALATAFFLLPLYAMLVTSFKYAEEIRSTSLLALPGSLNWSAWGTAWQSACTGVDC 75 VYA L+ L P Y M VT+FK EE+ N+ + W + T + Sbjct: 21 VYAPLSAFLIILLFPFYWMTVTTFKSNEEL-----------YNFKDYNPLWIHSPTLDNV 69 Query: 76 NGLR------PFFMNSVAMAVPAVLISTVWGALNGYVLSLWKFRGSDALFGMLLFGVFMP 129 L + + ++ +AV A IS L Y + +F+G + M+ +P Sbjct: 70 KRLLFDTDYPQWLVITMTVAVVATAISLFASVLAAYAIQRLRFKGGQTVGLMIYLAYLVP 129 Query: 130 FQVVLLPMSQVLGWLGLSSSITGLVLVHCLAGLAGTTLFFRNYYAAIPKELVNAARMDGA 189 ++ +P++ ++ GL S L+L + + T Y+ +IP EL A +DGA Sbjct: 130 PSILFIPLATMVFQFGLYDSPMALILTYPTFLIPFCTWLLMGYFKSIPYELEECALVDGA 189 Query: 190 SFFQIFWRIVLPLSTPIVMVTLIWQFTNIWNDFLFGVVF-SGTDSKPVTVG-LNNLANTS 247 S QI W+I LPL+ P ++ I+ FT WN+F++ + F S + K V V L L Sbjct: 190 SRIQILWKITLPLAVPGLISAGIFAFTLSWNEFIYALAFISSVEKKTVPVAVLTQL--VE 247 Query: 248 SSVKAYNVDMAAAIIAGLPTMVIYVLAGKFFVRGLTAGAVK 288 V + MA A++ LP VIY + +V LT GAVK Sbjct: 248 GDVYHWGSLMAGALLGSLPVAVIYSFFVEHYVSSLT-GAVK 287 Lambda K H 0.327 0.139 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 288 Length adjustment: 26 Effective length of query: 263 Effective length of database: 262 Effective search space: 68906 Effective search space used: 68906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory