Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate WP_037448510.1 N825_RS06700 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::psRCH2:GFF857 (371 letters) >NCBI__GCF_000576635.1:WP_037448510.1 Length = 378 Score = 429 bits (1104), Expect = e-125 Identities = 218/367 (59%), Positives = 264/367 (71%), Gaps = 1/367 (0%) Query: 1 MASVTLRDICKSYDGTPITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGDL 60 MA VTLRD+ KS+ G I +DLDI D EF VFVGPSGCGKSTLLRLIAGLEDITSG++ Sbjct: 1 MADVTLRDVRKSFGGVEIIHGVDLDIRDNEFTVFVGPSGCGKSTLLRLIAGLEDITSGEM 60 Query: 61 LIDNQRVNDLPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEAVAEI 120 ID RVNDLPPK+R + MVFQSYALYPHMTV +NMAFGLKLA+ K I R+V A Sbjct: 61 TIDGVRVNDLPPKERGISMVFQSYALYPHMTVYDNMAFGLKLANSGKDAINRKVREAAGT 120 Query: 121 LQLDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEIARLH 180 LQ++ LL+RKP+DLSGGQRQRVAIGR +VREPKVFLFDEPLSNLDA LRVQMRIE+A+L Sbjct: 121 LQIESLLDRKPRDLSGGQRQRVAIGRAIVREPKVFLFDEPLSNLDAALRVQMRIELAKLK 180 Query: 181 QRIRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGFLGSPQMN 240 + +TM+YVTHDQVEAMTLADKIVVL AG + Q G PL LYH+P+N FVAGF+GSP+MN Sbjct: 181 DDLNATMVYVTHDQVEAMTLADKIVVLRAGHVEQAGSPLELYHHPRNLFVAGFIGSPRMN 240 Query: 241 FVEVRAISASPETVTIELPSGYPLTLPVDGSAVSPGDPLTLGIRPEHFVMPDEADFTFHG 300 +E + +S + TI++P G +T+P + ++ G P+TLGIRPEH V D+ D Sbjct: 241 LIETKVVSTDRDGATIQIPGGDTMTVPAQAAGLAHGAPVTLGIRPEHLVEADQGDTILDC 300 Query: 301 QITVAERLGQYNLLYLTLERLQDVITLCVDGNLRVTEGETFAAGLKADKCHLFRENGEAC 360 + V ERLG ++ + Q ++ L DG V GE G+ A CHLF +G A Sbjct: 301 TVFVVERLGGETYCHVRIADGQTLV-LRTDGETTVRPGEPIRVGIPAAACHLFDRDGMAL 359 Query: 361 TRHYREP 367 R R P Sbjct: 360 HRLQRHP 366 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 494 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 378 Length adjustment: 30 Effective length of query: 341 Effective length of database: 348 Effective search space: 118668 Effective search space used: 118668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory