Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_037454711.1 N825_RS16865 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_000576635.1:WP_037454711.1 Length = 362 Score = 329 bits (844), Expect = 7e-95 Identities = 185/363 (50%), Positives = 233/363 (64%), Gaps = 7/363 (1%) Query: 1 MARVLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEG 60 MA V + + K Y GQ E + +++I+D+EF V VGPSGCGK+T LRM+AGLE IT G Sbjct: 1 MASVGIAQVRKAY-GQHE-VIHGIDIEIEDEEFVVLVGPSGCGKSTLLRMVAGLEQITGG 58 Query: 61 NLYIGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAA 120 + IG VN VPPK+RDIAMVFQNYALYPHMTV+ NMAF L+LRK + +RV+EAA Sbjct: 59 EIAIGGTVVNLVPPKERDIAMVFQNYALYPHMTVFNNMAFSLQLRKSDPDMVQKRVREAA 118 Query: 121 KILDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRK 180 IL + LDR P+ LSGGQRQRVA+GRAIVR+PQVFL DEPLSNLDAKLRVQMR EI+ Sbjct: 119 DILGLVPYLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVQMRTEIKA 178 Query: 181 LHQRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPA 240 LHQRL+TT IYVTHDQ EAMTM DRIVVM DG ++Q TP +Y P N FVAGFIGSP+ Sbjct: 179 LHQRLRTTSIYVTHDQVEAMTMADRIVVMHDGHVEQIGTPLELYDYPANTFVAGFIGSPS 238 Query: 241 MNFIRGEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDEEVFM 300 MNF G +DG A + +R P + +A+ G+ V G+RP L Sbjct: 239 MNFFNGTFRRDGRAAWVEVAG-DIRFPV--EPLTRAND--GQSVTYGIRPGHLTLVNGDA 293 Query: 301 TTYPDSVLQMQVEVVEHMGSEVYLHTSIGPNTIVARVNPRHVYHVGSSVKLAIDLNKIHI 360 + ++V+E G + + + A RH + G ++ L + H+ Sbjct: 294 APGFPKGVAATIQVIEPTGDDTVVFCRMANQEACAMFVERHAFRPGDTIMLMPRMANGHV 353 Query: 361 FDA 363 FD+ Sbjct: 354 FDS 356 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 362 Length adjustment: 30 Effective length of query: 354 Effective length of database: 332 Effective search space: 117528 Effective search space used: 117528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory