Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_037448510.1 N825_RS06700 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_000576635.1:WP_037448510.1 Length = 378 Score = 320 bits (819), Expect = 5e-92 Identities = 178/353 (50%), Positives = 224/353 (63%), Gaps = 22/353 (6%) Query: 21 VENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGNLYIDDKLMNDASPKDRDIA 80 + +LDI D EF VFVGPSGCGKST LR+IAGLEDIT G + ID +ND PK+R I+ Sbjct: 19 IHGVDLDIRDNEFTVFVGPSGCGKSTLLRLIAGLEDITSGEMTIDGVRVNDLPPKERGIS 78 Query: 81 MVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAAEILGLTEFLERKPADLSGGQ 140 MVFQ+YALYPHM+VY+NMAFGLKL KD IN++V EAA L + L+RKP DLSGGQ Sbjct: 79 MVFQSYALYPHMTVYDNMAFGLKLANSGKDAINRKVREAAGTLQIESLLDRKPRDLSGGQ 138 Query: 141 RQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKIHRRIGATTIYVTHDQTEAM 200 RQRVA+GRAIVR+ KVFL DEPLSNLDA LRV MR E+AK+ + AT +YVTHDQ EAM Sbjct: 139 RQRVAIGRAIVREPKVFLFDEPLSNLDAALRVQMRIELAKLKDDLNATMVYVTHDQVEAM 198 Query: 201 TLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANKFVAGFIGSPAMNFFEVTVEK 260 TLAD+IV++ A G +EQ G+P ELY+ P N FVAGFIGSP MN E V Sbjct: 199 TLADKIVVLRA----------GHVEQAGSPLELYHHPRNLFVAGFIGSPRMNLIETKVVS 248 Query: 261 ERLVNQDGLSLALPQGQEKILEEKG---YLGKKVTLGIRPEDISSDQIVHETFPNASVTA 317 ++DG ++ +P G + + G VTLGIRPE +V + + Sbjct: 249 ---TDRDGATIQIPGGDTMTVPAQAAGLAHGAPVTLGIRPE-----HLVEADQGDTILDC 300 Query: 318 DILVSELLGSESMLYVKFGSTE-FTARVNARDSHSPGEKVQLTFNIAKGHFFD 369 + V E LG E+ +V+ + R + + PGE +++ A H FD Sbjct: 301 TVFVVERLGGETYCHVRIADGQTLVLRTDGETTVRPGEPIRVGIPAAACHLFD 353 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 378 Length adjustment: 30 Effective length of query: 347 Effective length of database: 348 Effective search space: 120756 Effective search space used: 120756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory