Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_037449677.1 N825_RS08300 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= BRENDA::Q8NMV1 (376 letters) >NCBI__GCF_000576635.1:WP_037449677.1 Length = 358 Score = 322 bits (824), Expect = 1e-92 Identities = 178/377 (47%), Positives = 236/377 (62%), Gaps = 21/377 (5%) Query: 1 MATVTFKDASLSYPGAKEPTVKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDG 60 MA V + +Y G E +K + + DGEFLV++GPSGCGKST LRM+AGLE ++ G Sbjct: 1 MAEVGIRGVRKTYAGGFE-AIKGIDCAVGDGEFLVMLGPSGCGKSTLLRMVAGLETISAG 59 Query: 61 AIFIGDKDVTHVAPRDRDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAA 120 + IG + V + P+DRDIAMVFQNYALYPHMTV +NM + LKI G S+ +I RV +A+ Sbjct: 60 EVSIGGRVVNDLEPKDRDIAMVFQNYALYPHMTVYDNMAYGLKIRGMSKADIESRVHKAS 119 Query: 121 ATLGLTEFLERKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAA 180 L L FL+R+P+ LSGGQRQRVAMGRAIVR P+VFL DEPLSNLDAKLR Q R +I Sbjct: 120 DILELRPFLDRRPRQLSGGQRQRVAMGRAIVREPKVFLFDEPLSNLDAKLRTQMRVEINR 179 Query: 181 LQRKLGVTTVYVTHDQTEALTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPA 240 LQ +LG+T++YVTHDQ EA+T+ DR+ V+ G +Q+G P E+Y RPA+ FVAGFIGSPA Sbjct: 180 LQDRLGITSLYVTHDQVEAMTLADRMMVMNGGVAEQIGTPMEVYHRPASTFVAGFIGSPA 239 Query: 241 MNL--GTFSVKDGDATSGHARIKLSPETLAAMTPEDNGRITIGFRPEALEIIPEGESTDL 298 MN + + GHA + L + A + IT+G RPE L + E Sbjct: 240 MNFLPARLTASGVELNGGHA-VPLPAGSGGASAARE---ITLGIRPEHLTL--ESGQGIG 293 Query: 299 SIPIKLDFVEELGSDSFLYGKLVGEGDLGSSSEDVPESGQIVVRAAPNAAPAPGSVFHAR 358 I +K++ +E LG+D+ ++ +L GD ++ R +A + G H Sbjct: 294 DIAVKVELIEALGADTVVHARLTSSGD------------PLLARLPGSARVSNGDTLHFA 341 Query: 359 IVEGGQHNFSASTGKRL 375 I G H F TG+RL Sbjct: 342 ITPGEVHLFDRQTGRRL 358 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 358 Length adjustment: 30 Effective length of query: 346 Effective length of database: 328 Effective search space: 113488 Effective search space used: 113488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory