Align MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate WP_037449677.1 N825_RS08300 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= TCDB::O30494 (367 letters) >NCBI__GCF_000576635.1:WP_037449677.1 Length = 358 Score = 367 bits (943), Expect = e-106 Identities = 187/356 (52%), Positives = 250/356 (70%), Gaps = 8/356 (2%) Query: 1 MANLKIKNLQKGFEG-FSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSEGT 59 MA + I+ ++K + G F IKGID V D EF+V +GPSGCGKSTLLR++AGLE +S G Sbjct: 1 MAEVGIRGVRKTYAGGFEAIKGIDCAVGDGEFLVMLGPSGCGKSTLLRMVAGLETISAGE 60 Query: 60 IELDGRDITEVTPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVDKQLVESKVNEAAR 119 + + GR + ++ P RD+AMVFQ YALYPHM+V NM++ L + G+ K +ES+V++A+ Sbjct: 61 VSIGGRVVNDLEPKDRDIAMVFQNYALYPHMTVYDNMAYGLKIRGMSKADIESRVHKASD 120 Query: 120 ILELGPLLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARL 179 ILEL P L+R+P+QLSGGQRQRVA+GRAIVR PK+FLFDEPLSNLDA LR QMR+E+ RL Sbjct: 121 ILELRPFLDRRPRQLSGGQRQRVAMGRAIVREPKVFLFDEPLSNLDAKLRTQMRVEINRL 180 Query: 180 HKELQATMIYVTHDQVEAMTLADKVVVLNSGRIEQVGSPLELYHQPANLFVAGFLGTPKM 239 L T +YVTHDQVEAMTLAD+++V+N G EQ+G+P+E+YH+PA+ FVAGF+G+P M Sbjct: 181 QDRLGITSLYVTHDQVEAMTLADRMMVMNGGVAEQIGTPMEVYHRPASTFVAGFIGSPAM 240 Query: 240 GFLKGKVTRVDGQGCEVQLDAGTLISLPLSGASLSVGSAVTLGIRPEHLEIAS-PGQTTL 298 FL ++T V+L+ G + LP S +TLGIRPEHL + S G + Sbjct: 241 NFLPARLT-----ASGVELNGGHAVPLPAGSGGASAAREITLGIRPEHLTLESGQGIGDI 295 Query: 299 TVTADVGERLGSDTFCHV-ITSNGEPLTMRIRGDMASQYGETLHLHLDPAHCHLFD 353 V ++ E LG+DT H +TS+G+PL R+ G G+TLH + P HLFD Sbjct: 296 AVKVELIEALGADTVVHARLTSSGDPLLARLPGSARVSNGDTLHFAITPGEVHLFD 351 Lambda K H 0.319 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 358 Length adjustment: 29 Effective length of query: 338 Effective length of database: 329 Effective search space: 111202 Effective search space used: 111202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory