Align Inositol transport system ATP-binding protein (characterized)
to candidate WP_037456329.1 N825_RS20590 sugar ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >NCBI__GCF_000576635.1:WP_037456329.1 Length = 259 Score = 192 bits (489), Expect = 5e-54 Identities = 106/259 (40%), Positives = 155/259 (59%), Gaps = 8/259 (3%) Query: 1 MSMSQPLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPT 60 M+ S PL+ M+ I FG + A+ GV+V + PGE LLG NGAGKST IK +SG ++ Sbjct: 1 MTGSVPLVEMRDISIQFGGIKAVDGVTVTLHPGEVVGLLGHNGAGKSTLIKILSGAYQAN 60 Query: 61 KGDILFEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFD 120 G IL GQP+ PRDA A GI T++Q LA+ + N F+G E + G L D Sbjct: 61 TGSILINGQPVDIRSPRDAKALGIETIYQTLALADNIDAPGNLFLGRELMTPWGTL---D 117 Query: 121 HDYANRITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALG 180 D R T + M ++ N R + V LSGG+RQ+VAIARA+HF AK+LI+DEPT+ALG Sbjct: 118 DDAMERATRDVMGRLNPNFRKIKEPVKNLSGGQRQSVAIARALHFNAKILIMDEPTAALG 177 Query: 181 VRQTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEEL 240 ++T V I +++K+G+ + I+H++ + DR +V+ GK +GT + +++ +E+ Sbjct: 178 PQETKQVAELIKQLKKEGIGIFLISHDLHDVFDLSDRVSVMKNGKLVGTCRTSEVTKDEV 237 Query: 241 QDM-----MAGGQELATLE 254 M + G Q A LE Sbjct: 238 LGMIILGKLPGQQTAAELE 256 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 259 Length adjustment: 24 Effective length of query: 237 Effective length of database: 235 Effective search space: 55695 Effective search space used: 55695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory