Align Inositol transport system permease protein (characterized)
to candidate WP_051511581.1 N825_RS05320 ABC transporter permease
Query= reanno::WCS417:GFF2333 (340 letters) >NCBI__GCF_000576635.1:WP_051511581.1 Length = 338 Score = 213 bits (542), Expect = 6e-60 Identities = 124/325 (38%), Positives = 194/325 (59%), Gaps = 27/325 (8%) Query: 19 RLPTELSIFLVLIGIGLVFELFGWIVRDQSFLMNSQRLVLMILQVSIIGLLAIGVTQVII 78 R + S L LI I +V L + ++++ + ++ +++G++AIG+T VI+ Sbjct: 34 RFLVQYSNVLALIVILVVASLLS------PYFLSTRNIFNVLRGATMVGIVAIGMTYVIL 87 Query: 79 TTGIDLSSGSVLALSAMIAASLAQTSDFSRAVFPSLTDLPVWIPVAMGLGVGLLAGAING 138 GIDLS GS++ LSA + AS A D + I ++GL GL+ G NG Sbjct: 88 NRGIDLSVGSLVGLSAALTASFA--------------DYGIGIAASIGLVSGLVLGLANG 133 Query: 139 SIIAVTGIPPFIATLGMMVSARGLARYYTEGQP--VSMLSDSYTAIGHG-----AMPVII 191 +I + PFIATLGMM+ ARGL YT G V +D++T +G +PV++ Sbjct: 134 LMITKLRLQPFIATLGMMIFARGLVFVYTNGSNIVVDKPTDAFTWLGSAYIGPVPVPVVV 193 Query: 192 FLVVAVIFHIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLIIVYSIAGLLAGLAGVVA 251 F+++ + + LRYT +G+ +A+G N +AAR SGINV R+ I VY I+G+LA AGV+ Sbjct: 194 FVLIWALCALVLRYTVFGREIFAVGANEEAARLSGINVDRNKIRVYCISGVLAAFAGVIM 253 Query: 252 SARAATGQAGMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGALILGVMASGFTFVGVD 311 ++R G+ G +ELDAIAA +IGGT+ GGVG + GTV+G LIL +++ + + Sbjct: 254 ASRLTVGEPNGGTLFELDAIAATLIGGTTFDGGVGSVHGTVLGVLILAFLSNVLNLLNIS 313 Query: 312 AYIQDIIKGLIIVVAVVIDQYRNKR 336 Y Q ++KG+IIV+AVV+ ++R ++ Sbjct: 314 PYSQMLLKGVIIVLAVVVSEWRKRK 338 Lambda K H 0.325 0.140 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 338 Length adjustment: 28 Effective length of query: 312 Effective length of database: 310 Effective search space: 96720 Effective search space used: 96720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory