Align Putrescine transport system permease protein PotI (characterized)
to candidate WP_037457428.1 N825_RS22875 ABC transporter permease
Query= SwissProt::P0AFL1 (281 letters) >NCBI__GCF_000576635.1:WP_037457428.1 Length = 263 Score = 156 bits (394), Expect = 5e-43 Identities = 90/244 (36%), Positives = 148/244 (60%), Gaps = 9/244 (3%) Query: 15 ILLLG-FTFLYAPMLMLVIYSFNSSKLVTVW-AGWSTRWYGELLRDDAMMSAVGLSLTIA 72 +L+ G + FL AP+L++V SF+ ++T W RWY ++ A+++A +SL++A Sbjct: 11 VLVTGLYLFLLAPILIVVPLSFSDDNILTFPPTSWGVRWYAQMFEHQALVNAFQVSLSLA 70 Query: 73 ACAATAAAILGTIAAVVLVRFGRFRGSNGFAFMITAPLVMPDVITGLSLLLLFVALAHAI 132 A + G AA L RF RFRG + + TAPL++P ++ GLS+LL+FV L Sbjct: 71 AIVTVLSLAAGIPAAYALHRF-RFRGRDALMNLFTAPLLLPSIVLGLSILLVFVKLQLLA 129 Query: 133 GWPADRGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVITLPM 192 + + + +AH+ T YV ++S+ L L S+EEAA LGA+PL VF +TLP+ Sbjct: 130 TF------VGLVVAHLIVTTPYVVRIMSTALTTLPPSVEEAATMLGASPLVVFRRVTLPL 183 Query: 193 IMPAIISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNPEINALATLILGA 252 +MP +++ L+F LS D++VI+ F++GP TTLP+ +F+ V +P I A++ +++ A Sbjct: 184 MMPGLVASAALSFLLSFDEVVISLFITGPHITTLPVEIFNYVESRTDPLIAAVSVVLVAA 243 Query: 253 VGIV 256 +V Sbjct: 244 TLLV 247 Lambda K H 0.330 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 263 Length adjustment: 25 Effective length of query: 256 Effective length of database: 238 Effective search space: 60928 Effective search space used: 60928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory