Align MtlG, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate WP_037460635.1 N825_RS31785 carbohydrate ABC transporter permease
Query= TCDB::O30493 (276 letters) >NCBI__GCF_000576635.1:WP_037460635.1 Length = 274 Score = 167 bits (422), Expect = 3e-46 Identities = 91/263 (34%), Positives = 144/263 (54%), Gaps = 7/263 (2%) Query: 17 LAWAIAILIFFPIFWMVLTSFKTEIDAFATPPQFIFTPTLENYLHINERSNYFSYAWN-- 74 LA A I FP+ WM FK FA P F+FTPTLE++ ++ E + WN Sbjct: 15 LAVLYAFAILFPVIWMASMMFKPADVMFARPTVFLFTPTLEHFDYVIE----LGFVWNLL 70 Query: 75 -SVLISFSATALCLLISVPAAYSMAFYETKRTKSTLLWMLSTKMLPPVGVLMPIYLLAKS 133 S L+ +TAL +LI PAAY+ A +E + L++L+++M PPV +++P YL+ Sbjct: 71 TSFLLCTISTALVVLIGTPAAYAFARFEMRGKDDLFLFILASRMGPPVCLVIPFYLIFAK 130 Query: 134 FGLLDTRIALIIIYTLINLPIVVWMVYTYFKDIPKDILEAARLDGATLWQEMVRVLLPIA 193 GL+DT L + Y NL VW++ ++ +D+P ++ EAA L+G + Q RV+ P+ Sbjct: 131 IGLIDTFAGLTLAYMTFNLSFYVWVLRSFCRDLPVELEEAAALEGWSRPQIFRRVVFPLL 190 Query: 194 KGGLASTVLLSLILCWNEAFWSLNLTSSNAAPLTALIASYSSPEGLFWAKLSAVSTLACA 253 + G+ +T +L I WNE ++ L L I + +G+ W +++ V +A Sbjct: 191 RNGIVATAVLCFIFAWNEFLFAFMLGGKTVQTLPVAIPKLITSQGVRWGEMAVVGIVALV 250 Query: 254 PILIFGWISQKQLVRGLSFGAVK 276 P+L Q+ +VRGL+ GAVK Sbjct: 251 PVLAVVIALQRHIVRGLTLGAVK 273 Lambda K H 0.327 0.137 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 274 Length adjustment: 25 Effective length of query: 251 Effective length of database: 249 Effective search space: 62499 Effective search space used: 62499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory