Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_037454069.1 N825_RS16595 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_000576635.1:WP_037454069.1 Length = 354 Score = 211 bits (536), Expect = 3e-59 Identities = 127/359 (35%), Positives = 203/359 (56%), Gaps = 36/359 (10%) Query: 1 MTTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPT 60 M ++ + ++ K + G +V + VS+ I G ++GPSG GK+T LR++AGLE T Sbjct: 1 MASVEIRDVRKAY--GAAQV--LHGVSVDIQDGEFVILVGPSGCGKSTLLRMLAGLESIT 56 Query: 61 SGYIYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIE 120 G I V+ + P++R IAMVFQN+ALYP+MTV +N+AF ++L + K IE Sbjct: 57 GGEIRIGPRVVND-----VPPKERDIAMVFQNYALYPHMTVAENMAFSMRLRRAKKSDIE 111 Query: 121 NKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRES 180 +V + ++ LGL+ +L+RYPKELSGGQ QR A+ RA+V+DPKV L DEP SNLDA++R + Sbjct: 112 VRVNKAADILGLTKLLDRYPKELSGGQRQRVAMGRAIVRDPKVFLFDEPLSNLDAKLRVA 171 Query: 181 ARALVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIA 240 RA ++++ + K TT+ V+HD + +A+K V+ +G Q+G P E+Y+ P +A Sbjct: 172 MRAEIKELHQRLKTTTVYVTHDQIEAMTMADKIVVMRDGIVEQMGAPLELYDRPGNVFVA 231 Query: 241 RLTGE--INLIQAKIIENNAIIAN--LKVPLNNMELKGQS----NIVIGLRPDDLTLSDT 292 G +NL++ + IE A + + +++PL G + + GLRP+ +TLSD Sbjct: 232 GFIGSPAMNLLEGR-IEGGAFVTSGGMRLPLPTDRFTGAAASGRPAIYGLRPEHITLSDA 290 Query: 293 LLDKYIDMGIVKVKLVSYGAGIFKIVVSPITDENIDIIVDAEEPLETGIETHLLAKPNK 351 G + +VV P E + ++ L+ + +L P + Sbjct: 291 ------------------GVPVEVVVVEPTGSETLIVVKGGHTELDCLFRSRILPNPGE 331 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 354 Length adjustment: 29 Effective length of query: 342 Effective length of database: 325 Effective search space: 111150 Effective search space used: 111150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory