Align D-lactate dehydrogenase (acceptor) (EC 1.1.99.6) (characterized)
to candidate WP_037458870.1 N825_RS27050 FAD-binding protein
Query= BRENDA::O29853 (443 letters) >NCBI__GCF_000576635.1:WP_037458870.1 Length = 495 Score = 228 bits (581), Expect = 3e-64 Identities = 156/448 (34%), Positives = 238/448 (53%), Gaps = 23/448 (5%) Query: 13 VFPPSDAYRFDETPPLVAPRAAENFVVVKPSNSEEVSAILKFANEKSIPVFMRGGGTGLS 72 V D R ET L A R VVV P+ +E+VS +LK+ NE I V RG GT LS Sbjct: 30 VIAERDEMRVYETDALTAYRQLP-MVVVLPNTTEQVSQVLKYCNEVGIKVVPRGAGTSLS 88 Query: 73 GGAVPTEEGIVLSTEKMTEL-EVDADNRVAICGAGVTLKQLDDAAFRHGLSFPPHPGAET 131 GGA+P +GI+L K ++ ++D NR GVT + +A G + P P ++ Sbjct: 89 GGALPLADGIILGLGKFNKIVDIDYANRTVTAQPGVTNLGITNAVAHEGFYYAPDPSSQI 148 Query: 132 A-TVGGMIATNAGGVRALKYGTMRNYVLSLEAVLADGRIINVGGKTIKNSSGYSLLHLLV 190 A T+GG IA N+GGV LKYG N VL +E VL +G II +GGK + +S GY LL ++ Sbjct: 149 ACTIGGNIAENSGGVHCLKYGLTTNNVLGIEMVLMNGDIIRLGGKHL-DSDGYDLLGVMT 207 Query: 191 GSEGTLAVITKATIRLFPQMRDMTVLAIPFPTMEDAMNCVVE-VARKMLPMALEFMEKRA 249 GSEG L V+T+ T+R+ + + L I FP+ E +CV +A ++P +E M+K A Sbjct: 208 GSEGLLGVVTEVTVRILRKPETLRALLIGFPSSESGGDCVAAIIAAGIIPGGMEMMDKPA 267 Query: 250 VEIGEKVSGERWVSREGEAHLLMVFESFDEAE------EAAKIAQSLGAIDVYAATTKKD 303 + E+ + + EA LL+V EAE E KIA + GA+ + + ++ + Sbjct: 268 IHAAEEFVHAGY-PMDVEA-LLIVELDGPEAEVHHLIGEVEKIALTCGAVSIRISESEDE 325 Query: 304 QDRLLKVRGMIYEGLRKEVIEVL--DACVPPAKIAEYWRRSNELAEEYGIELITYGHAGD 361 + R + + + + L D +P ++ R E++ ++G+ + HAGD Sbjct: 326 RMVFWAGRKAAFPAVGRISPDYLCMDGTIPRKQLPLVLTRMAEMSVKHGLRVANVFHAGD 385 Query: 362 GNVHQHPLVY-----EGWEKSYFEFRKSLLSLAVSLGGVISGEHGIGAVKLSELEELFPE 416 GN+ HPL+ G ++ +F +L L V +GGV++GEHG+G K + F E Sbjct: 386 GNL--HPLILYDANKPGELQAAEDFGADILKLCVEVGGVLTGEHGVGVEKRDLMNHQFTE 443 Query: 417 -QFELMRQIKLLFDPKNILNPGKVVRKL 443 +++K FDP+ +LNPGKV +L Sbjct: 444 VDLNQQQRVKCAFDPEALLNPGKVFPQL 471 Lambda K H 0.317 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 29 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 495 Length adjustment: 33 Effective length of query: 410 Effective length of database: 462 Effective search space: 189420 Effective search space used: 189420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory