Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate WP_037452166.1 N825_RS13095 ribose ABC transporter permease
Query= TCDB::G4FGN4 (313 letters) >NCBI__GCF_000576635.1:WP_037452166.1 Length = 338 Score = 202 bits (513), Expect = 1e-56 Identities = 119/298 (39%), Positives = 172/298 (57%), Gaps = 3/298 (1%) Query: 12 GIFLILIAIVVFLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVIITSGIDLSVGSIL 71 G+ +LI I + T +FLT NI V+ S +++ G+T VI+T GIDL+VG++L Sbjct: 36 GMLPVLILICIGFEFATGKFLTARNISIVMQQASINIVLATGLTFVILTGGIDLAVGAVL 95 Query: 72 GAASVVMGLLMDEKGLSPFLSVVIGLAVGVGFGLANGLLITKARLAPFISTLGMLSVGRG 131 A S V + M G+ P L++ + L VG+ G NG LI RL PFI TLG ++ RG Sbjct: 96 -AVSAVTAVSMTLTGM-PDLAIPLALLVGLALGAVNGSLIAFFRLPPFIVTLGAMTAVRG 153 Query: 132 LAYVMSGGWPISPFPESFTVHGQGMVGPVPVPVIYMAVIGVIAHIFLKYTVTGRRIYAIG 191 L+ + + + F G + +P VI + I+ L+ TV G IY +G Sbjct: 154 LSRLSANDTTVFNAALPFAWIGNSQLFGIPWMVIIALAVVAISWFVLRRTVLGVWIYGVG 213 Query: 192 GNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTA-WLGVAQPNAGQGYELDVIAATV 250 GN +A++L GIK +L+ VY I+G LA AG + A L G GYELD IAA + Sbjct: 214 GNPDAARLSGIKVWAVLLFVYAISGMLAGLAGVMSAARTLSANGAQLGMGYELDAIAAVI 273 Query: 251 IGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQVVIGIVIIIAIAIDQIR 308 +GGTS GG G+I G +GA+I+ VL NG+IL+ VS WQ ++ G+VI+ A+A+D+ R Sbjct: 274 LGGTSFVGGIGSIFGTLIGALIIAVLSNGLILMNVSEVWQLIIKGLVIVGAVALDRYR 331 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 338 Length adjustment: 28 Effective length of query: 285 Effective length of database: 310 Effective search space: 88350 Effective search space used: 88350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory