Align TreU, component of Trehalose porter (characterized)
to candidate WP_037457428.1 N825_RS22875 ABC transporter permease
Query= TCDB::Q97ZC1 (267 letters) >NCBI__GCF_000576635.1:WP_037457428.1 Length = 263 Score = 101 bits (251), Expect = 2e-26 Identities = 70/244 (28%), Positives = 126/244 (51%), Gaps = 11/244 (4%) Query: 10 IVVGIYF--LFPLYILVLLAFNSPKYTVLAKFPSLLPVSLTLNNLLTALQGTAFIDPFIK 67 +V G+Y L P+ I+V L+F+ + FP P S + + A ++ F Sbjct: 12 LVTGLYLFLLAPILIVVPLSFSDDN---ILTFP---PTSWGVRWYAQMFEHQALVNAFQV 65 Query: 68 SLETATLVGIITIALAIPAGYGLSRLPRAIAYSIIILLLVTNMMPAIVIGIPIAVDFLKL 127 SL A +V ++++A IPA Y L R +++ L ++P+IV+G+ I + F+KL Sbjct: 66 SLSLAAIVTVLSLAAGIPAAYALHRFRFRGRDALMNLFTAPLLLPSIVLGLSILLVFVKL 125 Query: 128 HLFESVVGLALAQTLITLPLATFILQGTFSSIPIDLEHQARVDGANLFNRLFSVLLPLAA 187 L + VGL +A ++T P I+ +++P +E A + GA+ V LPL Sbjct: 126 QLLATFVGLVVAHLIVTTPYVVRIMSTALTTLPPSVEEAATMLGASPLVVFRRVTLPLMM 185 Query: 188 PGIAAAFLISWMFSWDEFTYAILLI-PYHSTLPVTI--YQDVTRGNLLAGIAFSLIFTLP 244 PG+ A+ +S++ S+DE ++ + P+ +TLPV I Y + L+A ++ L+ Sbjct: 186 PGLVASAALSFLLSFDEVVISLFITGPHITTLPVEIFNYVESRTDPLIAAVSVVLVAATL 245 Query: 245 VIIL 248 +++L Sbjct: 246 LVVL 249 Lambda K H 0.330 0.146 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 263 Length adjustment: 25 Effective length of query: 242 Effective length of database: 238 Effective search space: 57596 Effective search space used: 57596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory