Align TreV, component of Trehalose porter (characterized)
to candidate WP_037449677.1 N825_RS08300 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_000576635.1:WP_037449677.1 Length = 358 Score = 238 bits (607), Expect = 2e-67 Identities = 132/287 (45%), Positives = 182/287 (63%), Gaps = 26/287 (9%) Query: 18 INGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIADGADITDKPPEKRNVA 77 I GI + GEF V+LGPSG GKSTLL+++AG+E + G++ G + D P+ R++A Sbjct: 20 IKGIDCAVGDGEFLVMLGPSGCGKSTLLRMVAGLETISAGEVSIGGRVVNDLEPKDRDIA 79 Query: 78 MVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLLGISEILDKKVTQISGGQ 137 MVFQNYALYP+M+V DN+A+ LK+RGM K +I RV KA+ +L + LD++ Q+SGGQ Sbjct: 80 MVFQNYALYPHMTVYDNMAYGLKIRGMSKADIESRVHKASDILELRPFLDRRPRQLSGGQ 139 Query: 138 QQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQKELKGTFIYVTHDQKEAL 197 +QRVA+ RAIVR P FL DEPLSNLDA++RT R E+ R+Q L T +YVTHDQ EA+ Sbjct: 140 RQRVAMGRAIVREPKVFLFDEPLSNLDAKLRTQMRVEINRLQDRLGITSLYVTHDQVEAM 199 Query: 198 SLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGEFPMNFLPGELM----------- 246 +LADR+ +++ G EQ+ P +Y P + +VA F+G MNFLP L Sbjct: 200 TLADRMMVMNGGVAEQIGTPMEVYHRPASTFVAGFIGSPAMNFLPARLTASGVELNGGHA 259 Query: 247 ---------KEKAQEI--GFRPEWVEV----GKGNLSCMVESVEASG 278 A+EI G RPE + + G G+++ VE +EA G Sbjct: 260 VPLPAGSGGASAAREITLGIRPEHLTLESGQGIGDIAVKVELIEALG 306 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 358 Length adjustment: 28 Effective length of query: 296 Effective length of database: 330 Effective search space: 97680 Effective search space used: 97680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory