Align Putative xylitol transport system substrate-binding protein; SubName: Full=Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate WP_037446129.1 N825_RS02245 substrate-binding domain-containing protein
Query= uniprot:A0A1N7UEK0 (335 letters) >NCBI__GCF_000576635.1:WP_037446129.1 Length = 380 Score = 93.6 bits (231), Expect = 7e-24 Identities = 68/204 (33%), Positives = 101/204 (49%), Gaps = 12/204 (5%) Query: 9 ATAALSLLACSIAMAADG------KTYKVGAAVYGLKGQFM---QNWVRELKEHPAVKDG 59 A A L LLA A++A G K +K+ ++ + + N ++ + HP + G Sbjct: 9 AAACLGLLATGAAVSAPGDAAAQDKKHKIFLSMSYIGNDWQAEASNMIKAMAAHPDMA-G 67 Query: 60 TVQLTVFDGNYDALTQNNQIENMVTQRYDAILFVPIDTKAGVGTVKAAMSNDVVVIASNT 119 V L V +A Q QI +MV +AI+ PI A VK A VVVIA + Sbjct: 68 KVDLQVQVSGPNAQKQIQQINSMVQAGAEAIVVYPISPTALNQVVKNACGKGVVVIAYDA 127 Query: 120 KVADASVPYVGNDDVEGGRLQAQAMVDKLNGKGNVVIIQGPIGQSAQIDREKGELEVLGK 179 ++++ V D E GR+ A+ + +K+NGKGN++ I G G S R K V K Sbjct: 128 EISEPCAYNVSIDQEEAGRVTAEWLAEKMNGKGNIIAITGVPGTSVDTLRTKAAKAVFSK 187 Query: 180 HPDIKIIEKKTANWDRAQALALTE 203 HPD+KI+ + W +QA+A TE Sbjct: 188 HPDMKIVAEAPGMW--SQAVARTE 209 Lambda K H 0.314 0.130 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 380 Length adjustment: 29 Effective length of query: 306 Effective length of database: 351 Effective search space: 107406 Effective search space used: 107406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory