Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate WP_037455444.1 N825_RS18890 ABC transporter permease
Query= uniprot:A0A1N7UKA9 (325 letters) >NCBI__GCF_000576635.1:WP_037455444.1 Length = 344 Score = 205 bits (521), Expect = 1e-57 Identities = 127/322 (39%), Positives = 183/322 (56%), Gaps = 9/322 (2%) Query: 13 APRNRLRLSLDRFGLPLVFILLCVVMAFSSEYFMTWRNWMDILRQTSINGILAVGMTYVI 72 A N LR L L + L V + +S F T N +IL Q SI I+AVG+TYVI Sbjct: 15 AVMNWLRGRLSNIAPFLTLLFLIVFFSIASPSFATLGNVGNILNQISITAIMAVGLTYVI 74 Query: 73 LTKGIDLSVGSILAFAGLCSAMVATQ-GYGLLAAVSAGMFAGAML--------GVVNGFM 123 L IDLSV S+ G+ A Q Y +A V +A +L G VN F Sbjct: 75 LCAEIDLSVASVANATGIVLAYFTLQDSYANIANVPVDGWAAILLALASCFALGAVNAFG 134 Query: 124 VANLSIPPFVATLGMLSIARGMTFILNDGSPITDLPDAYLALGIGKIGPIGVPIIIFAVV 183 V + IP F+ TL ML I G+ +L G ++P LG +GPI +I+ AV Sbjct: 135 VTRIGIPSFIMTLAMLQIGAGICAMLVRGQIAYNVPPLIATLGQKALGPIPYVVIVAAVF 194 Query: 184 ALIFWMVLRYTTYGRYVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSART 243 L+ +VL YT +GRYVY VGGN ++A SG+ V+ V+ SV ++S + +G AG+V A Sbjct: 195 LLVGHLVLTYTRFGRYVYMVGGNREAAEYSGVNVKLVLASVMIISAVCSGTAGMVGVAYF 254 Query: 244 TSALPQAGVSYELDAIAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQ 303 SA SY LD+I+AVV+GGTSL GG G I T+ G L++GV+NNGL+ + + S+ + Sbjct: 255 GSAQQNEFDSYLLDSISAVVVGGTSLFGGRGGIGNTIVGLLVLGVLNNGLDHINIDSFLK 314 Query: 304 QVAKGLIIVFAVLIDVWRKKKR 325 + +GLI++ A++I+++ ++ R Sbjct: 315 ILIRGLILLAALIINIYAQRLR 336 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 344 Length adjustment: 28 Effective length of query: 297 Effective length of database: 316 Effective search space: 93852 Effective search space used: 93852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory