Align L-iditol 2-dehydrogenase; EC 1.1.1.14 (characterized)
to candidate WP_037459296.1 N825_RS28175 L-idonate 5-dehydrogenase
Query= CharProtDB::CH_000596 (353 letters) >NCBI__GCF_000576635.1:WP_037459296.1 Length = 349 Score = 226 bits (575), Expect = 9e-64 Identities = 122/343 (35%), Positives = 184/343 (53%), Gaps = 7/343 (2%) Query: 11 AAVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNYVVEKPFILGH 70 AA + ++++ P+ ++ V +K A GICGSD+HYY + R G++VV P +LGH Sbjct: 7 AATLFGPEDLRMVERPLDRLDPGMVRVKFGAGGICGSDMHYYRHARTGDFVVTSPLVLGH 66 Query: 71 ECAGEIAAVGSSVDQFKVGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFLA----TPPVD 126 E AGEI +GS V VGD VAV P CG C C+EGR NLC ++ F+ TP + Sbjct: 67 EVAGEIVELGSGVTGLAVGDHVAVNPSRWCGHCVRCREGRENLCENIYFMGSASKTPHMQ 126 Query: 127 GAFVQYIKMRQDFVFLIPDSLSYEEAALIEPFSVGIHAAARTKLQPGSTIAIMGMGPVGL 186 G F +P L + AAL EP +V +HA AR G + G GP+GL Sbjct: 127 GGFSSLFDATAAQCVRVPADLPFSAAALAEPLAVCLHAVARAGAMEGHKAIVFGAGPIGL 186 Query: 187 MAVAAAKAFGAGTIIVTDLEPLRLEAAKKMGATHIINIREQDALEEIKTITNDRGVDVAW 246 + + AK GA + V D+ L A+K+GA H++++ DA ++ ++ G DV + Sbjct: 187 LTMLCAKLAGASEVAVVDVAAAPLAFAEKLGADHVVDVSGGDA--ALRDLSAQAGFDVGF 244 Query: 247 ETAGNPAALQSALASVRRGGKLAIVGLPSQNEIPLNVPFIADNEIDIYGIFRYANTYPKG 306 E +G PA L SA+ SVR+GG + +G + +P+ + E+D+ G FR+ Y + Sbjct: 245 EVSGTPAGLASAIGSVRKGGTVVQIGNLAGGLLPVPANAVMSKELDLKGTFRFGREYDRA 304 Query: 307 IEFLASGIVDTKHLVTDQYSLEQTQDAMERALQFKNECLKVMV 349 + + SG VD LVT + L DA AL + + +KV++ Sbjct: 305 VSLIVSGGVDVLKLVTAERPLSGAPDAFLLALD-RTQSVKVVL 346 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 349 Length adjustment: 29 Effective length of query: 324 Effective length of database: 320 Effective search space: 103680 Effective search space used: 103680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory