Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_025331759.1 SALWKB2_RS11165 SDR family oxidoreductase
Query= reanno::pseudo1_N1B4:Pf1N1B4_412 (272 letters) >NCBI__GCF_000600005.1:WP_025331759.1 Length = 297 Score = 99.0 bits (245), Expect = 1e-25 Identities = 81/268 (30%), Positives = 126/268 (47%), Gaps = 21/268 (7%) Query: 11 PEPPKGER-------LKNKVVLLTGAAQGIGEAIVATFASQQARLVISDIQGEK--VEKV 61 P P GER L + +L+TGA GIG A +A + A L I+ + E+ ++V Sbjct: 35 PVPDCGERSYEGHGRLHGRKILVTGADSGIGRAAAIAYAREGADLAINYLPAEEEDAKQV 94 Query: 62 AAHWREQGADVVAIKADVSRQQDLHAMARLAIELH---GRIDVLVNCAGVNVFRDPL-QM 117 AA +E G VV I D+S D H +L + H G +D L AG + + Sbjct: 95 AALAQEAGRKVVCIPGDLS---DEHFCKQLVEKAHTELGGLDGLTLVAGKQTAVERFCDI 151 Query: 118 TEEDWHRCFAIDLDGAWYGCKAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGL 177 + E + F +++ ++ + +P + +I+ +S + P Y K G+ Sbjct: 152 STEQLKKTFEVNIFSLFWVIQTAMPHL--PAGATIVTTSSVQAYQPSPNLVDYATTKAGI 209 Query: 178 LGLTRALGIEYAPKGIRVNAIAPGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQP 237 + T+AL + A KGIRVN++APG I T L + G P A + R GQP Sbjct: 210 VAFTQALAKQVAAKGIRVNSVAPGPIWTALEI---TGGQPPEAIPKFGQSESVLGRAGQP 266 Query: 238 IEVAMTAVFLASDEAPFINASCITIDGG 265 E+A T VFL S+E+ ++ A + GG Sbjct: 267 AELASTYVFLMSEESSYVTAQVYGVTGG 294 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 297 Length adjustment: 26 Effective length of query: 246 Effective length of database: 271 Effective search space: 66666 Effective search space used: 66666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory