Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_025331193.1 SALWKB2_RS08205 polyamine ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >NCBI__GCF_000600005.1:WP_025331193.1 Length = 376 Score = 235 bits (599), Expect = 2e-66 Identities = 130/303 (42%), Positives = 181/303 (59%), Gaps = 28/303 (9%) Query: 4 IQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDIYIG 63 +Q+ D+ K +GD AVD ++L I E L+G SG GKST LRMLAG+ETPT G I + Sbjct: 17 LQIKDIVKTYGDNYAVDHINLTIKKNEIFALLGSSGSGKSTLLRMLAGMETPTQGQIILD 76 Query: 64 GDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEVAETLG 123 G+ + P +R I M+FQ YAL+PHMTV QNI FGL++++ E RV E+ + Sbjct: 77 GEDITKLQPYDRPINMMFQSYALFPHMTVEQNIAFGLKQDK-LPKDEISARVEEMLRLVQ 135 Query: 124 IADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQNLQDQ 183 ++ RKP +LSGGQQQRVAL R++ + P++ L+DEPL LD KLR + + EL N ++ Sbjct: 136 MSKYAKRKPHQLSGGQQQRVALARSLAKRPKLLLLDEPLGALDKKLRQQTQLELVNTLEK 195 Query: 184 LAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGEPMINLV 243 + T + VTH+Q EAMTMA RIA+M DG+LQQV +P + Y PN+ F AEF+GE N++ Sbjct: 196 VGATCIMVTHDQEEAMTMASRIAIMSDGQLQQVGTPSDIYDYPNSRFTAEFMGE--TNIL 253 Query: 244 RGTRSES---------------TFVGEHFSYPLDEDVMESVDDRDDFVLGVRPEDIEVAD 288 G +E ++G S P D+ + L +RPEDI + Sbjct: 254 EGKVTEDGADHTIIHCPEMQQLVYLGHGISGPEDQKIW----------LSIRPEDINIYR 303 Query: 289 AAP 291 P Sbjct: 304 EQP 306 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 376 Length adjustment: 30 Effective length of query: 353 Effective length of database: 346 Effective search space: 122138 Effective search space used: 122138 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory