Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate WP_025331193.1 SALWKB2_RS08205 polyamine ABC transporter ATP-binding protein
Query= TCDB::P96483 (377 letters) >NCBI__GCF_000600005.1:WP_025331193.1 Length = 376 Score = 222 bits (565), Expect = 2e-62 Identities = 115/276 (41%), Positives = 172/276 (62%), Gaps = 6/276 (2%) Query: 17 DKPAVDQLDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGGAIRIGDRDVTHLPPKD 76 D AVD +++ I+ E L+G SG GKST LRMLAG+E G I + D+T L P D Sbjct: 28 DNYAVDHINLTIKKNEIFALLGSSGSGKSTLLRMLAGMETPTQGQIILDGEDITKLQPYD 87 Query: 77 RDIAMVFQNYALYPHMTVADNMGFALKIAGVPKAEIRQKVEEAAKILDLTQYLDRKPKAL 136 R I M+FQ+YAL+PHMTV N+ F LK +PK EI +VEE +++ +++Y RKP L Sbjct: 88 RPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKDEISARVEEMLRLVQMSKYAKRKPHQL 147 Query: 137 SGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIASLQRRLGITTVYVTHDQ 196 SGGQ+QRVA+ R++ + P++ L+DEPL LD KLR T+ ++ + ++G T + VTHDQ Sbjct: 148 SGGQQQRVALARSLAKRPKLLLLDEPLGALDKKLRQQTQLELVNTLEKVGATCIMVTHDQ 207 Query: 197 VEAMTMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIGSPAMNLVEVPITDGGVKFG 256 EAMTM R+A++ DG LQQV +P ++YD P + F A F+G N++E +T+ G Sbjct: 208 EEAMTMASRIAIMSDGQLQQVGTPSDIYDYPNSRFTAEFMGE--TNILEGKVTEDGADHT 265 Query: 257 NSVVPVNREAL----SAADKGDRTVTVGVRPEHFDV 288 P ++ + + D+ + + +RPE ++ Sbjct: 266 IIHCPEMQQLVYLGHGISGPEDQKIWLSIRPEDINI 301 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 376 Length adjustment: 30 Effective length of query: 347 Effective length of database: 346 Effective search space: 120062 Effective search space used: 120062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory