Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate WP_025329798.1 SALWKB2_RS00760 amino acid ABC transporter ATP-binding protein
Query= uniprot:Q6MNM2 (347 letters) >NCBI__GCF_000600005.1:WP_025329798.1 Length = 242 Score = 151 bits (381), Expect = 2e-41 Identities = 85/236 (36%), Positives = 135/236 (57%), Gaps = 6/236 (2%) Query: 4 IQFSNIKKSFGSADVLKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSGTISID 63 I+F N+ K F V+ G++L ++ GE +V+ GPSG GKSTL+RT+ LE G I +D Sbjct: 2 IEFKNVHKWFKDLHVINGVNLTVSQGEVVVVCGPSGSGKSTLIRTVNQLEKIQQGEIWVD 61 Query: 64 GKKI----NDIEPQNRDIAMVFQSYALYPHMTVAENMGFG-LKLKNLAAAEITKRVNEIS 118 G + D+ ++ VFQ + LYPH+TV EN+ +K+K + A+ + E+ Sbjct: 62 GINVADPKADLNRVRTEVGFVFQHFNLYPHLTVLENIILSPMKVKKESRAQAEAKAKELL 121 Query: 119 ELLQIKHLLDRKPKELSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQMRLEIKR 178 + + H D P++LSGGQ+QRVA+ R L+ + V+LFDEP S LD + ++ L++ + Sbjct: 122 AKVGLAHKCDAFPQQLSGGQQQRVAIARGLAMEPRVMLFDEPTSALDPEMIGEV-LKVMK 180 Query: 179 LHHNSKSTMIYVTHDQMEATTLGDRIAVLKDGVIEQIGTPSEIYHRPKNTFIATFI 234 S TM+ VTH+ A + DR+ + G I + TP E + RP++ F+ Sbjct: 181 DLALSGMTMMVVTHEMGFAREVADRVVFIDHGEIVEEATPEEFFQRPQHERAQQFL 236 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 242 Length adjustment: 26 Effective length of query: 321 Effective length of database: 216 Effective search space: 69336 Effective search space used: 69336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory