Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_025331514.1 SALWKB2_RS09875 ABC transporter ATP-binding protein
Query= SwissProt::Q9YGA6 (372 letters) >NCBI__GCF_000600005.1:WP_025331514.1 Length = 311 Score = 165 bits (417), Expect = 2e-45 Identities = 86/231 (37%), Positives = 136/231 (58%), Gaps = 6/231 (2%) Query: 11 KVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADP 70 K F + ++SLEV DG+ + +LG SG GK+T L M AGL +P G I+I ++ + Sbjct: 9 KKFSDKVVAADLSLEVADGQLVAVLGESGSGKSTLLNMAAGLVQPDSGNIFINEENIT-- 66 Query: 71 EKGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLT 130 F+ P+ R I ++FQ YAL PH+ V+ N+AF L++ +V + + + ++ +GL+ Sbjct: 67 ----FLLPEQRRIGLMFQDYALLPHLNVWQNVAFGLRMHRVSKPQAQHQAMQMLAEVGLS 122 Query: 131 ELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLG 190 E R+ LSGG++QRVAL RA+V +PQ L+DEP S LD LR ++ +L RQ Sbjct: 123 EAAARQVDVLSGGEQQRVALARALVLQPQALLLDEPFSALDTTLRASLQQLTVRLLRQQK 182 Query: 191 VTTIYVTHDQVEAMTMGDRIAVMNRGVLQQVGSPDEVYDKPANTFVAGFIG 241 + VTH +EA + DRI ++ G Q G+ ++ +PA+ + A +G Sbjct: 183 CPAVLVTHSPLEAFALADRICLLRHGRWIQQGTAAQLLARPADAWAARLLG 233 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 311 Length adjustment: 28 Effective length of query: 344 Effective length of database: 283 Effective search space: 97352 Effective search space used: 97352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory