Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_025329853.1 SALWKB2_RS01070 sulfate ABC transporter ATP-binding protein
Query= TCDB::Q8YT15 (247 letters) >NCBI__GCF_000600005.1:WP_025329853.1 Length = 360 Score = 95.5 bits (236), Expect = 1e-24 Identities = 66/222 (29%), Positives = 114/222 (51%), Gaps = 10/222 (4%) Query: 21 YIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKITFKGKNIAGLK 80 Y D LQ +N +V +G L ++GP+G GK+TL + I GL +G++ F ++ L Sbjct: 11 YYGDYQALQNINLQVPTGSLTALLGPSGCGKTTLLRIIAGLERADSGELFFADDEVSNLH 70 Query: 81 SNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIRNDSLQPLKDKI------FAMFPRLS 134 + R+G + Q +F ++V +N+ G + ++P K +I +L Sbjct: 71 VRE-RRVGFMF--QHYALFRHMTVFDNVAFGLQVLPKRIRPNKAEIADRVHELLQLVQLD 127 Query: 135 DRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFEQVKQI-NQEG 193 + LSGG+RQ +A+ +AL P LL+LDEP AL + ++ + + +I +Q G Sbjct: 128 WLAKVYPQQLSGGQRQRIALARALATRPKLLLLDEPFGALDAKVRKELRQWLLEIHHQLG 187 Query: 194 TAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPK 235 +LV + +ALEMA++ V+ G+ SG L +P+ Sbjct: 188 ITSVLVTHDQEEALEMAEQIVVMNQGKVEQSGAASSLYDNPE 229 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 360 Length adjustment: 26 Effective length of query: 221 Effective length of database: 334 Effective search space: 73814 Effective search space used: 73814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory