Align GtsD (GLcK), component of Glucose porter, GtsABCD (characterized)
to candidate WP_025329848.1 SALWKB2_RS01045 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q88P35 (384 letters) >NCBI__GCF_000600005.1:WP_025329848.1 Length = 251 Score = 124 bits (312), Expect = 2e-33 Identities = 86/255 (33%), Positives = 139/255 (54%), Gaps = 28/255 (10%) Query: 4 LELRNVNKTYGSGLPDTLKDIQLSIKDGEFLILVGPSGCGKSTLMNCIAGLEQITGGAIL 63 ++ R + K +G+ + LK + + + E + ++G SG GKSTL+ C+ LE+I G+I Sbjct: 2 IDARGIYKAFGN--TEVLKGVDIQVARSEVVAIIGSSGSGKSTLLRCLNYLEKIDAGSIA 59 Query: 64 IDEQDVSGMSPKDRD--------------IAMVFQSYALYPTMSVRENI-EFGLKIRKLP 108 I+ + + +R + MVFQ + L+P M+V +NI E + ++K+ Sbjct: 60 IENDFLVQNNIHNRAHYVSEGLIKKICTRMGMVFQQFNLFPHMTVLQNIIEAPITVKKMK 119 Query: 109 QAAIDEEVARVAKLLQIEHLLARK----PAQLSGGQQQRVAMGRALARRPKIYLFDEPLS 164 + +E+ +A+ L + LA K P+QLSGGQ+QRVA+ RALA +P+I LFDEP S Sbjct: 120 R----DEIVPLAQELLRKVGLANKQDYYPSQLSGGQKQRVAIARALAMQPQIMLFDEPTS 175 Query: 165 NLDAKLRVE-MRTEMKLMHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPQQI 223 LD +L E ++T +L R+ T V VTH+ A + DKV M G+I + G Sbjct: 176 ALDPELTGEVLKTMQQLAEDRM--TMVVVTHEMGFAREVADKVLFMDKGVIVEAGEASSF 233 Query: 224 YNDPANQFVASFIGS 238 + +P + F+ S Sbjct: 234 FANPQHTRTQEFLSS 248 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 251 Length adjustment: 27 Effective length of query: 357 Effective length of database: 224 Effective search space: 79968 Effective search space used: 79968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory