Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_025329670.1 SALWKB2_RS00060 D-2-hydroxyacid dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000600005.1:WP_025329670.1 Length = 312 Score = 132 bits (333), Expect = 8e-36 Identities = 94/298 (31%), Positives = 140/298 (46%), Gaps = 11/298 (3%) Query: 9 SLPEDVLAYLQQHAQVVQVDATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALST 68 +LPE + H + T D + A+ I + V+I + + RL+ ++ Sbjct: 13 TLPEYPFNFKFPH-HITSYSHTSPDEVADRIAQANIVISNKVRINAEAIRNSPRLQLIAV 71 Query: 69 ISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQH 128 + G D D + + + N ++ A+ LILA R++ V AG W++ Sbjct: 72 PATGLDHIDRQTAQQHNVGIRNVRGYGNDTVAEHAMMLILALMRQLPAYQRDVAAGLWEN 131 Query: 129 SIGPALFGV---DVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGA 185 S FG D+ GKTLGI G G IG A+A RA F M VL+ + Y Sbjct: 132 SPFFCHFGAPIHDLNGKTLGIFGKGGIGQALAARAQ-AFGMHVLWGEHKNASSCRDGY-- 188 Query: 186 RRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKALIEA 245 +LL AD V L PL +T+++I AELK MK A+LIN RG V E+ L+ A Sbjct: 189 --TPFTQLLQQADVVSLHCPLNEQTRNMIDEAELKMMKPQAVLINVGRGGLVAEQPLVAA 246 Query: 246 LQNGTIHGAGLDVFETEPLPSDSPLLK--LANVVALPHIGSATHETRHAMARNAAENL 301 L+ G + GAG+DV EP +PLL+ L N++ PHI + E + +N+ Sbjct: 247 LKYGQLGGAGVDVLSEEPPVHGNPLLRAHLPNLIITPHIAWGSEEAIQRICSMLEDNI 304 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 312 Length adjustment: 27 Effective length of query: 294 Effective length of database: 285 Effective search space: 83790 Effective search space used: 83790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory