Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_025331514.1 SALWKB2_RS09875 ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_000600005.1:WP_025331514.1 Length = 311 Score = 160 bits (405), Expect = 5e-44 Identities = 88/216 (40%), Positives = 129/216 (59%), Gaps = 4/216 (1%) Query: 23 LDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRIGGTVVNDLPARERNVAMVF 82 L L + DG+ V +LG SG GKST+L M AGL G + I + L +R + ++F Sbjct: 20 LSLEVADGQLVAVLGESGSGKSTLLNMAAGLVQPDSGNIFINEENITFLLPEQRRIGLMF 79 Query: 83 QNYALYPHMSVYDNIAFGLR--RLKRPAAEIDRRVREVAALLNLEALLERKPRAMSGGQQ 140 Q+YAL PH++V+ N+AFGLR R+ +P A+ + ++ A + L R+ +SGG+Q Sbjct: 80 QDYALLPHLNVWQNVAFGLRMHRVSKPQAQ--HQAMQMLAEVGLSEAAARQVDVLSGGEQ 137 Query: 141 QRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRTTTVYVTHDQLEAMT 200 QR A+ARA++ P L DEP S LD LRA L+ RL ++ + V VTH LEA Sbjct: 138 QRVALARALVLQPQALLLDEPFSALDTTLRASLQQLTVRLLRQQKCPAVLVTHSPLEAFA 197 Query: 201 LADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIG 236 LADR+ L++ GR +Q G+ A+L P + +AA +G Sbjct: 198 LADRICLLRHGRWIQQGTAAQLLARPADAWAARLLG 233 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 259 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 311 Length adjustment: 29 Effective length of query: 377 Effective length of database: 282 Effective search space: 106314 Effective search space used: 106314 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory