GapMind for catabolism of small carbon sources

 

Protein WP_007497860.1 in Bacillus altitudinis 41KF2b

Annotation: NCBI__GCF_000691145.1:WP_007497860.1

Length: 214 amino acids

Source: GCF_000691145.1 in NCBI

Candidate for 22 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism Ac3H11_2554 med ABC transporter for L-Histidine, permease component 1 (characterized) 40% 91% 154.5 Arginine transport system permease protein ArtQ 38% 169.9
L-asparagine catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 38% 96% 147.5 Arginine transport system permease protein ArtQ 38% 169.9
L-aspartate catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 38% 96% 147.5 Arginine transport system permease protein ArtQ 38% 169.9
L-glutamate catabolism gltK lo Glutamate/aspartate import permease protein GltK (characterized) 38% 96% 147.5 Arginine transport system permease protein ArtQ 38% 169.9
D-glucosamine (chitosamine) catabolism AO353_21715 lo ABC transporter for D-Glucosamine Hydrochloride, permease component 2 (characterized) 34% 94% 135.2 Arginine transport system permease protein ArtQ 38% 169.9
L-lysine catabolism hisQ lo ABC transporter for L-Lysine, permease component 1 (characterized) 34% 88% 133.3 Arginine transport system permease protein ArtQ 38% 169.9
L-arginine catabolism artQ lo Histidine transport system permease protein HisQ (characterized) 34% 93% 125.2 Arginine transport system permease protein ArtQ 38% 169.9
L-histidine catabolism hisQ lo Histidine transport system permease protein HisQ (characterized) 34% 93% 125.2 Arginine transport system permease protein ArtQ 38% 169.9
L-arginine catabolism artM lo ABC transporter for L-Arginine, permease component 2 (characterized) 33% 94% 124 Arginine transport system permease protein ArtQ 38% 169.9
L-histidine catabolism aapM lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized) 35% 54% 123.6 Arginine transport system permease protein ArtQ 38% 169.9
L-asparagine catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 34% 54% 121.7 Arginine transport system permease protein ArtQ 38% 169.9
L-aspartate catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 34% 54% 121.7 Arginine transport system permease protein ArtQ 38% 169.9
L-citrulline catabolism AO353_03045 lo ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized) 32% 94% 121.7 Arginine transport system permease protein ArtQ 38% 169.9
L-citrulline catabolism AO353_03050 lo ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized) 32% 93% 121.7 Arginine transport system permease protein ArtQ 38% 169.9
L-asparagine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 55% 116.7 Arginine transport system permease protein ArtQ 38% 169.9
L-aspartate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 55% 116.7 Arginine transport system permease protein ArtQ 38% 169.9
L-glutamate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 55% 116.7 Arginine transport system permease protein ArtQ 38% 169.9
L-leucine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 55% 116.7 Arginine transport system permease protein ArtQ 38% 169.9
L-proline catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 55% 116.7 Arginine transport system permease protein ArtQ 38% 169.9
L-citrulline catabolism PS417_17600 lo ABC transporter permease; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine ABC transporter permease HisM; SubName: Full=Histidine transport system permease protein; SubName: Full=Histidine/lysine/arginine/ornithine ABC transporter permease HisM (characterized, see rationale) 32% 88% 111.7 Arginine transport system permease protein ArtQ 38% 169.9
L-asparagine catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 31% 98% 107.8 Arginine transport system permease protein ArtQ 38% 169.9
L-aspartate catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 31% 98% 107.8 Arginine transport system permease protein ArtQ 38% 169.9

Sequence Analysis Tools

View WP_007497860.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MDTIVNAFPYLMDGLQTTLYIFVVAIILGFIIGLIVALFRLSPFKILNFISLVFVNAIRG
TPFIVQLFFIYFGLNTLEFISLDRVPAGIITVAINAGAYFSEIIRAGIQSIDKGQTEAAR
SLGFTGGQNMRFIVLPQAFRRMLPAITNQAIISLKDTSLLSIIGIADIMQRGQVQASATF
DPLNVWLIVGVIYFVIIYLLSLLASYAERRFDVK

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory