Align BadK (characterized)
to candidate WP_035701941.1 BA79_RS07305 enoyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_000691145.1:WP_035701941.1 Length = 259 Score = 161 bits (408), Expect = 1e-44 Identities = 100/246 (40%), Positives = 138/246 (56%), Gaps = 4/246 (1%) Query: 13 RVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGADIASMAA 72 + +IT+ P NAL+ L+ L + + + AIVI G R F+AGADI Sbjct: 12 QTALITIQHPPA-NALSSQLLTELNDMFDQLEQNSEVRAIVIHGEGRFFSAGADIKEFTT 70 Query: 73 WSYSDVYGS--NFITRNWETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGRSAKFAL 130 Y S + + +E I Q KPV+A++ G A GGG ELA++CDI IA + AK L Sbjct: 71 LQEESDYASLADRGQQVFERIEQCPKPVIASIHGAALGGGLELAMSCDIRIATKDAKLGL 130 Query: 131 PEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVD-DDRLRDE 189 PE+ LG++PG GGTQRLPR +G AKA++M +A P+ EEA GLVS++ + +D + Sbjct: 131 PELNLGIIPGFGGTQRLPRYVGSAKALEMMGTAEPITGEEAFACGLVSKLAETEDEALET 190 Query: 190 TVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAREGIQAFLE 249 LA AA S L + E LN + G+ E ++ F S DA+EGIQAF+E Sbjct: 191 AKTLAAKFAAKSPKTLEYVLELLNATKVYSYDGGMKLEAKKFGEVFQSNDAKEGIQAFIE 250 Query: 250 KRAPCF 255 KR P F Sbjct: 251 KRKPNF 256 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory