Align N-succinylglutamate 5-semialdehyde dehydrogenase; Succinylglutamic semialdehyde dehydrogenase; SGSD; EC 1.2.1.71 (characterized)
to candidate WP_035701124.1 BA79_RS04010 betaine-aldehyde dehydrogenase
Query= SwissProt::Q8ZPV0 (492 letters) >NCBI__GCF_000691145.1:WP_035701124.1 Length = 489 Score = 198 bits (503), Expect = 4e-55 Identities = 157/465 (33%), Positives = 235/465 (50%), Gaps = 28/465 (6%) Query: 2 TLWINGDWITGQ-GERRRKTNPVSAEILWQGNDANAAQVAEACQAARAAFPR--WARQPF 58 TL+I+G W+ + G+ R NP + E++ ++ + A +AAR F + WA P Sbjct: 4 TLFIDGQWVGAKSGDTRDIINPFNQEVIATVSEGSRNDAQLAIKAARETFDQGDWANMPG 63 Query: 59 AARQAIVEKFAALLEAHKAELTEVIARETGKPRWEAATEVTAMINKIAISIKAYHA---- 114 R IV K A L+ EL ++ + +TGK E+ ++ + N + Y+A Sbjct: 64 LERGNIVFKIAELIRRDLDELAKLESLDTGKTLEESKADMDDIAN-----VFQYYAGLAD 118 Query: 115 RTGAQ--KSELVDGAATLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTLIFKPSEL 172 + G + S + + + L P GV P+N+P + I PAL AGNT++ KPSE+ Sbjct: 119 KDGGEIIASPIPNSKSELVREPVGVCGQITPWNYPLLQASWKIAPALAAGNTIVLKPSEI 178 Query: 173 TPWTGETVIKLWERAGLPAGVLNLVQG-GRETGQALSSLDDLDGLLFTGSASTGYQLHRQ 231 TP T V KL E AG+PAGV NLV G G G L+ D +D + FTG TG ++ + Sbjct: 179 TPLTTIKVFKLMEEAGVPAGVANLVLGPGATVGDELAVNDQVDLISFTGGIETGKKIMQG 238 Query: 232 LSGQPEKILALEMGGNNPLIIEDAANIDAAVHLTLQSAFITAGQRCTCARRLLVKQGAQG 291 SG +KI ALE+GG NP I+ A++D AV + + F AGQ C+ RLLV++ Sbjct: 239 ASGNVKKI-ALELGGKNPNIVFQDADLDVAVDQAMNAVFFHAGQVCSAGSRLLVEESIH- 296 Query: 292 DAFLARLVDVAGRLQPGR-WDDDPQPFIGGLISAQAAQHVMEAWRQREALGGRTLLAPRK 350 D FL LV +++ G +D+ Q G LISA+ + V E + G TL K Sbjct: 297 DEFLEELVKRTKKIKLGNGFDEGTQS--GPLISAEHREKV-EKYVSIGLDEGATLETGGK 353 Query: 351 ------VKEGTSLLTPGIIELTGVADVPDEEVFGPLLNVWRYAHFDEAIRLANNTRFGLS 404 +++G L T + EEVFGP+L V + +E I LAN+T +GL+ Sbjct: 354 RPDAEELQKGFFYLPTIFSGCTSEMRIVQEEVFGPVLTVETFRSEEEVIELANDTIYGLA 413 Query: 405 CGLVSTDRAQFEQLLLEARAGIVNWNKPLTGAASTAPFGGVGASG 449 + S+D + E++ + R G V W + AP+GG SG Sbjct: 414 GAVWSSDIGKAERVARQLRLGTV-WINDFHPYFAQAPWGGYKQSG 457 Lambda K H 0.319 0.134 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 573 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 489 Length adjustment: 34 Effective length of query: 458 Effective length of database: 455 Effective search space: 208390 Effective search space used: 208390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory